BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31635 (469 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22E12.11c |set3||histone lysine methyltransferase Set3|Schiz... 25 7.6 SPAC1F3.06c |spo15||sporulation protein Spo15|Schizosaccharomyce... 25 7.6 >SPAC22E12.11c |set3||histone lysine methyltransferase Set3|Schizosaccharomyces pombe|chr 1|||Manual Length = 859 Score = 24.6 bits (51), Expect = 7.6 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +2 Query: 80 FVFTFHIHMINLKFGLMFYSSVEYIL*LHLKALAVVNVL 196 +V++FH+ + L+ S++EY L LK L VL Sbjct: 170 YVYSFHLEYVPLESNTFSASALEYSKNLDLKNLDESEVL 208 >SPAC1F3.06c |spo15||sporulation protein Spo15|Schizosaccharomyces pombe|chr 1|||Manual Length = 1957 Score = 24.6 bits (51), Expect = 7.6 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -1 Query: 121 ELKIDHVNMKCKNETI 74 EL+ DHVNM+ +N T+ Sbjct: 798 ELRDDHVNMQSQNNTL 813 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,726,991 Number of Sequences: 5004 Number of extensions: 31100 Number of successful extensions: 57 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 57 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 178394480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -