BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31626 (516 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 42 0.006 UniRef50_Q8SV02 Cluster: Putative uncharacterized protein ECU07_... 33 5.1 UniRef50_Q3S2X9 Cluster: Gly; n=2; Streptococcus agalactiae|Rep:... 32 6.8 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 42.3 bits (95), Expect = 0.006 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 356 AGWWYLPARTHKRSYHK 306 A WWYLPARTHKRSYH+ Sbjct: 569 AEWWYLPARTHKRSYHR 585 >UniRef50_Q8SV02 Cluster: Putative uncharacterized protein ECU07_0900; n=1; Encephalitozoon cuniculi|Rep: Putative uncharacterized protein ECU07_0900 - Encephalitozoon cuniculi Length = 372 Score = 32.7 bits (71), Expect = 5.1 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -3 Query: 394 SNRNALLLHGRNRQGGGTYPRGL 326 + RNALL+HG N G TY RGL Sbjct: 112 TKRNALLVHGFNGSGNSTYMRGL 134 >UniRef50_Q3S2X9 Cluster: Gly; n=2; Streptococcus agalactiae|Rep: Gly - Streptococcus agalactiae Length = 570 Score = 32.3 bits (70), Expect = 6.8 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 2/64 (3%) Frame = +1 Query: 61 HDVYHMIAFNMAFKIYIKMAFSYITFYI*DMIGEWSMCNI-MSSRHQ*ISNTS-FRTSLQ 234 HD I ++ K++ K F+ ITF + D+ GE+++ N+ + SRH S+ + TS Sbjct: 435 HDNLKQIFPLLSMKLFRKSLFNNITFPLEDLTGEYTLYNVYLLSRHITFSHIGLYITSQV 494 Query: 235 FGQT 246 F T Sbjct: 495 FSHT 498 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 518,107,155 Number of Sequences: 1657284 Number of extensions: 10178042 Number of successful extensions: 19819 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19815 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 31782822356 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -