BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31626 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28540| Best HMM Match : Stig1 (HMM E-Value=2.6) 27 9.2 SB_4198| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_28540| Best HMM Match : Stig1 (HMM E-Value=2.6) Length = 465 Score = 27.1 bits (57), Expect = 9.2 Identities = 8/25 (32%), Positives = 18/25 (72%) Frame = +3 Query: 399 WGSRCNYTEILELISQGGWRIYVVD 473 WGS C +++++ + + GG+ +Y +D Sbjct: 127 WGSICQWSQMIRVKNCGGFYVYELD 151 >SB_4198| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1001 Score = 27.1 bits (57), Expect = 9.2 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 5/52 (9%) Frame = +2 Query: 185 HPDINKLVTRPLEL---LFSLVKRENYVSAVSMLNILVFPLIPIC--GRTSC 325 H D+ L + L L SLV R+N + S IL+ LIP+C G+ C Sbjct: 588 HDDLLTLFAQSLRQWHNLESLVLRDNAIGFQSKGKILIDALIPLCLKGKLKC 639 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,068,270 Number of Sequences: 59808 Number of extensions: 324167 Number of successful extensions: 508 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 507 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -