BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31622 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1703.04 |mlh1||MutL family protein Mlh1 |Schizosaccharomyces... 26 3.8 SPBC2D10.14c |myo51||myosin type V|Schizosaccharomyces pombe|chr... 25 5.1 >SPBC1703.04 |mlh1||MutL family protein Mlh1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 684 Score = 25.8 bits (54), Expect = 3.8 Identities = 13/43 (30%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = -3 Query: 502 QQSCM--VIKAHADFLIPLCI*PQHVDIKTLILVIFSVHDYSF 380 ++SC+ ++KA A F +PL + + D+K++ + + DY F Sbjct: 607 EKSCLNGIMKAIAKFYVPLPLSYEESDVKSIRSLESCLEDYLF 649 >SPBC2D10.14c |myo51||myosin type V|Schizosaccharomyces pombe|chr 2|||Manual Length = 1471 Score = 25.4 bits (53), Expect = 5.1 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +3 Query: 138 IMRRTIHCGVLQETPTSSSGKIQPDDDTIKKKILML 245 ++ +H G ++ T + +IQP D ++K L+L Sbjct: 328 LLAALLHLGNIEVCATRNEAQIQPGDGYLQKAALLL 363 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,185,198 Number of Sequences: 5004 Number of extensions: 44386 Number of successful extensions: 76 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -