BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31622 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0609 - 19196705-19196845,19196927-19196984,19197072-191971... 27 6.8 >10_08_0609 - 19196705-19196845,19196927-19196984,19197072-19197142, 19197352-19197428,19197500-19197582,19197659-19197718, 19198007-19198142,19198247-19198317,19198560-19198651, 19198785-19198882,19199012-19199164,19199254-19199419, 19200112-19200510,19200592-19200673,19200739-19200962 Length = 636 Score = 27.5 bits (58), Expect = 6.8 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Frame = +2 Query: 104 ILIHIYILNFAYYEEDHSL----WRTTGDAYIQQWKN 202 + + I + FA+ EED+ W+T + YI QW++ Sbjct: 376 LAVAILVTGFAFTEEDYMKPWEGWKTNLERYILQWES 412 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,762,022 Number of Sequences: 37544 Number of extensions: 238358 Number of successful extensions: 391 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 382 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 391 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -