BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31621 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 322 8e-89 SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 322 1e-88 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 321 2e-88 SB_56| Best HMM Match : Actin (HMM E-Value=0) 321 2e-88 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 321 2e-88 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 319 1e-87 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 257 5e-69 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 119 2e-27 SB_54| Best HMM Match : Actin (HMM E-Value=0) 106 1e-23 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 86 2e-17 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 68 5e-12 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) 47 1e-05 SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) 38 0.004 SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) 32 0.32 SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 3.0 SB_7681| Best HMM Match : Annexin (HMM E-Value=0) 29 3.0 SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_24438| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_46036| Best HMM Match : PSRT (HMM E-Value=1) 28 4.0 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_10094| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_4199| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_3885| Best HMM Match : Actin (HMM E-Value=0.77) 28 5.3 SB_45720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_19421| Best HMM Match : Ribosomal_L36 (HMM E-Value=0.85) 28 5.3 SB_47898| Best HMM Match : Extensin_2 (HMM E-Value=0.88) 27 6.9 SB_20153| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_34211| Best HMM Match : DUF1103 (HMM E-Value=6.4) 27 9.2 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 322 bits (792), Expect = 8e-89 Identities = 149/163 (91%), Positives = 157/163 (96%) Frame = +3 Query: 9 RXKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESC 188 + KLCYVALDFEQEM TAA+S+SLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGMES Sbjct: 176 KEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESA 235 Query: 189 GIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAP 368 GIHET YNSIMKCDVDIRKDLYANTV+SGGTTMYPGIADRMQKEI+ALAP T+KIKIIAP Sbjct: 236 GIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEISALAPPTMKIKIIAP 295 Query: 369 PERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 497 PERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 296 PERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 338 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 322 bits (791), Expect = 1e-88 Identities = 149/163 (91%), Positives = 157/163 (96%) Frame = +3 Query: 9 RXKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESC 188 + KLCYVALDFEQEM TAA+S+S+EKSYELPDGQVITIGNERFRCPEAL QPSFLGMES Sbjct: 187 KEKLCYVALDFEQEMQTAASSSSIEKSYELPDGQVITIGNERFRCPEALLQPSFLGMESS 246 Query: 189 GIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAP 368 GIHET YNSIMKCDVDIRKDLYANTVMSGGTTMYPG+ADRMQKEI+ALAPST+KIKIIAP Sbjct: 247 GIHETTYNSIMKCDVDIRKDLYANTVMSGGTTMYPGLADRMQKEISALAPSTMKIKIIAP 306 Query: 369 PERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 497 PERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 307 PERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 349 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 321 bits (789), Expect = 2e-88 Identities = 148/163 (90%), Positives = 157/163 (96%) Frame = +3 Query: 9 RXKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESC 188 + KLCYVALDFEQEM TAA+S+SLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGMES Sbjct: 214 KEKLCYVALDFEQEMETAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESA 273 Query: 189 GIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAP 368 GIHET YNSIMKCDVDIRKDLYANTV+SGG+TMYPGIADRMQKEIT+LAP T+KIKIIAP Sbjct: 274 GIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAP 333 Query: 369 PERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 497 PERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 334 PERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 321 bits (789), Expect = 2e-88 Identities = 148/163 (90%), Positives = 157/163 (96%) Frame = +3 Query: 9 RXKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESC 188 + KLCYVALDFEQEM TAA+S+SLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGMES Sbjct: 213 KEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESA 272 Query: 189 GIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAP 368 GIHET YNSIMKCDVDIRKDLYANTV+SGG+TMYPGIADRMQKEIT+LAP T+KIKIIAP Sbjct: 273 GIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAP 332 Query: 369 PERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 497 PERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 333 PERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 321 bits (789), Expect = 2e-88 Identities = 148/163 (90%), Positives = 157/163 (96%) Frame = +3 Query: 9 RXKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESC 188 + KLCYVALDFEQEM TAA+S+SLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGMES Sbjct: 214 KEKLCYVALDFEQEMTTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESA 273 Query: 189 GIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAP 368 GIHET YNSIMKCDVDIRKDLYANTV+SGG+TMYPGIADRMQKEI+ALAP T+KIKIIAP Sbjct: 274 GIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAP 333 Query: 369 PERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 497 PERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 334 PERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 319 bits (783), Expect = 1e-87 Identities = 148/163 (90%), Positives = 157/163 (96%) Frame = +3 Query: 9 RXKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESC 188 + KL YVALDFEQEMATAAAS+SLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGMES Sbjct: 213 KEKLAYVALDFEQEMATAAASSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESA 272 Query: 189 GIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAP 368 GIHET YNSIMKCDVDIRKDLYANTV+SGG+TM+PGIADRMQKEI+ALAP T+KIKIIAP Sbjct: 273 GIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEISALAPPTMKIKIIAP 332 Query: 369 PERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 497 PERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 333 PERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 257 bits (629), Expect = 5e-69 Identities = 116/145 (80%), Positives = 132/145 (91%) Frame = +3 Query: 63 AASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIR 242 A S LEK+YELPDGQVI+IGNERFRCPEA+FQP+FLGME+ GIHE +YN IMKCDVDIR Sbjct: 5 ANSPILEKTYELPDGQVISIGNERFRCPEAMFQPAFLGMEAPGIHEAIYNCIMKCDVDIR 64 Query: 243 KDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLS 422 KDLY+N V+SGG+TM+PGIADRMQKEI LA +++K+K+IAPPERKYSVWIGGSILASLS Sbjct: 65 KDLYSNCVLSGGSTMFPGIADRMQKEIAMLANASMKVKVIAPPERKYSVWIGGSILASLS 124 Query: 423 TFQQMWISKEEYDESGPGIVHRKCF 497 TFQQMWI+KEEY E GP IVHRKCF Sbjct: 125 TFQQMWIAKEEYHEYGPPIVHRKCF 149 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 119 bits (286), Expect = 2e-27 Identities = 68/183 (37%), Positives = 101/183 (55%), Gaps = 29/183 (15%) Frame = +3 Query: 9 RXKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESC 188 + KLCYV + EQE A +T L + Y LPDG+V+ + ERF PEALFQP + +E Sbjct: 217 KEKLCYVGYNIEQEQKLALETTVLVEQYTLPDGRVVKLSGERFEAPEALFQPHLINVEGV 276 Query: 189 GIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITAL------------ 332 G+ E ++N+I D+D R + Y + V+SGG+TMYPG+ R+++EI L Sbjct: 277 GVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLEREIKQLYLERVLKGDTSK 336 Query: 333 ---------APSTI-----KIKI-IAPP-ERKYSVWIGGSILAS-LSTFQQMWISKEEYD 461 P T K KI I P RK+ V++GG++LA + W++++EY+ Sbjct: 337 LSSGMGMEQIPLTADYLLQKFKIRIEDPPRRKHMVFMGGAVLADIMKDKDSFWMTRKEYE 396 Query: 462 ESG 470 E G Sbjct: 397 EKG 399 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 106 bits (254), Expect = 1e-23 Identities = 47/86 (54%), Positives = 61/86 (70%) Frame = +3 Query: 18 LCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIH 197 LCY A+D+E+E+ A S E Y LPDGQ I IG+ERFR E LFQPS LG + GIH Sbjct: 2261 LCYCAMDYERELKEAETSDDCEAPYMLPDGQSIRIGSERFRAAEPLFQPSLLGRDIDGIH 2320 Query: 198 ETVYNSIMKCDVDIRKDLYANTVMSG 275 E+++ SI KCD+D+R +L+ N V+SG Sbjct: 2321 ESIFKSIKKCDIDLRAELFHNIVLSG 2346 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 85.8 bits (203), Expect = 2e-17 Identities = 48/145 (33%), Positives = 74/145 (51%), Gaps = 17/145 (11%) Frame = +3 Query: 114 ITIGNERFRCPEALFQPSFLGME-SCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMY 290 + + ERF PE F P F + + + E V N I C +D+R+ LY N V+SGG+TM+ Sbjct: 196 VDVAYERFLGPEIFFHPEFSNPDFTTPLSEVVDNVIQNCPIDVRRPLYKNIVLSGGSTMF 255 Query: 291 PGIADRMQKEIT----------------ALAPSTIKIKIIAPPERKYSVWIGGSILASLS 422 R+Q++I + P I+ ++I+ ++Y+VW GGS+LAS Sbjct: 256 RDFGRRLQRDIKRTVDARLKMSETLSGGRIKPKPIETQVISHHMQRYAVWFGGSMLASTP 315 Query: 423 TFQQMWISKEEYDESGPGIVHRKCF 497 F + +K +YDE GP I F Sbjct: 316 EFYSVCHTKADYDEHGPSICRHNPF 340 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 67.7 bits (158), Expect = 5e-12 Identities = 29/85 (34%), Positives = 55/85 (64%), Gaps = 3/85 (3%) Frame = +3 Query: 174 GMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKI 353 G + G+ + V S+ D+DIR L+ + +++GG T+ G +R+ +E+ + P ++++ Sbjct: 146 GSTAMGVTQVVTTSVGMTDIDIRAGLFNSVIVTGGNTLLQGFVERLNRELVSKTPPSMRL 205 Query: 354 KII---APPERKYSVWIGGSILASL 419 K+I + E++++ WIGGSILASL Sbjct: 206 KLISNNSSVEKRFNPWIGGSILASL 230 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 54.0 bits (124), Expect = 7e-08 Identities = 33/104 (31%), Positives = 50/104 (48%), Gaps = 9/104 (8%) Frame = +3 Query: 180 ESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPST----- 344 E + + +S++ C +D RK L N V+ GGT M PG R+ +EI L S Sbjct: 54 EEKSLATALLDSLLLCPIDTRKTLAENIVLIGGTAMTPGFKHRLMQEIYLLLQSPKYKDK 113 Query: 345 --IK-IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKEEYDE 464 IK +K+ PP + W+GG+I SL ++E Y + Sbjct: 114 LFIKTVKMHQPPVNANITAWLGGAIFGSLEVLADRSTTRERYQQ 157 >SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) Length = 921 Score = 46.8 bits (106), Expect = 1e-05 Identities = 22/55 (40%), Positives = 32/55 (58%) Frame = +3 Query: 9 RXKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFL 173 + K+CY++ D +E+ + L K Y LPDGQ+I+IG E E LF+P L Sbjct: 844 KEKICYLSKDHLKEVHNYKTNEGLTKFYTLPDGQMISIGYECISSMEPLFRPDLL 898 >SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) Length = 367 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/35 (45%), Positives = 26/35 (74%) Frame = +3 Query: 192 IHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPG 296 I E + +I K D+D+R+ LY+N V+SGG+T++ G Sbjct: 257 IIEVLAFAIQKSDLDLRRVLYSNIVLSGGSTLFKG 291 >SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 32.7 bits (71), Expect = 0.18 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +3 Query: 144 PEALFQPSFLGMESCGIHETV 206 PE +FQPS LG+E GI ET+ Sbjct: 3 PEIIFQPSMLGLEQAGITETM 23 >SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) Length = 1079 Score = 31.9 bits (69), Expect = 0.32 Identities = 21/75 (28%), Positives = 36/75 (48%) Frame = +2 Query: 188 RHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDHRS 367 R P+DR + HH RR H +HR H R++R+ +G+ L+ +D Sbjct: 830 RPPQDRHRRHHHRRRHHN----NKHRKHSREHSRRRHQRKHHKGNDAQETLEEIFED--D 883 Query: 368 PREEVLRMDRWIHPG 412 R+E +D +++ G Sbjct: 884 ARDEKENVDEFVNGG 898 Score = 27.9 bits (59), Expect = 5.3 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = +2 Query: 164 FLPGYGIVRHP-RDRVQLHHEV-RRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRA 337 F+ G G++ H + Q+ E R + G +HRH R +HH ++ R+ + + A Sbjct: 894 FVNGGGMMEHELQSDSQISQETGARENDPGKKHKHRHRRHHHHRRQHNRKIKKHRRKHSA 953 Query: 338 LDHQ 349 H+ Sbjct: 954 RKHE 957 >SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1973 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -3 Query: 406 MDPPIHTEYFLSGGAMILILMVEGARAVISFCILSAIPGYMV-VPPD 269 +DPP+ +Y L+GG ++ ++ FCI G++V PP+ Sbjct: 758 LDPPLENKYNLNGGQQVIQSTLQIQSLFFPFCIFQ---GFVVPTPPE 801 >SB_7681| Best HMM Match : Annexin (HMM E-Value=0) Length = 426 Score = 28.7 bits (61), Expect = 3.0 Identities = 18/75 (24%), Positives = 29/75 (38%), Gaps = 2/75 (2%) Frame = +2 Query: 191 HPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDH--R 364 HP ++ HHE R P H H P ++ E P DH++++ Sbjct: 316 HPPEQ---HHEEEERGVHPPGEHHEEEERGAHPPGQDLEEEERGAHPPGQDHEEEERGAH 372 Query: 365 SPREEVLRMDRWIHP 409 P + +R +HP Sbjct: 373 PPEQHHEEEERGVHP 387 >SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 4.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +3 Query: 258 NTVMSGGTTMYPGIADRMQKEITALAP 338 N ++GG TMY R+++E+ A+ P Sbjct: 132 NVFVTGGNTMYNNFMARLERELLAIRP 158 >SB_24438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 4.0 Identities = 20/77 (25%), Positives = 29/77 (37%), Gaps = 4/77 (5%) Frame = +2 Query: 188 RHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYR--RQDAEGDHRPR--ALDHQDQ 355 RH R R + R RH RH H R++ R + R R H+ Sbjct: 23 RHERSRHETRQHERSRHKTSRHESSRHKTSRHERSRHKTSRHETSRHERSRHETRQHERS 82 Query: 356 DHRSPREEVLRMDRWIH 406 H++ R E R ++ H Sbjct: 83 RHKTSRHETSRHEKSRH 99 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 28.3 bits (60), Expect = 4.0 Identities = 18/69 (26%), Positives = 27/69 (39%) Frame = +2 Query: 143 SRGSLPAFLPGYGIVRHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGD 322 +R ++P LPG H R R HH ++H ++ HH Q + Sbjct: 930 ARPNMPGTLPGNYPESHKRHRHSHHHH------------YQHYQYNHHHDHQSHQHHDSH 977 Query: 323 HRPRALDHQ 349 H LDH+ Sbjct: 978 HHREVLDHK 986 >SB_46036| Best HMM Match : PSRT (HMM E-Value=1) Length = 878 Score = 28.3 bits (60), Expect = 4.0 Identities = 30/89 (33%), Positives = 36/89 (40%), Gaps = 3/89 (3%) Frame = +2 Query: 185 VRHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVP-RYRRQDAEGDHRPRALDHQDQD- 358 V HPR V +H HP V HR +H + RQDA DH + + H QD Sbjct: 606 VVHPRRDV-VHPRQDVVHPRQDVDHHRQDVDHHRQDVDHHRQDA--DHHRQDVVHPRQDV 662 Query: 359 -HRSPREEVLRMDRWIHPGFPVHLPADVD 442 HR + R D H VH D D Sbjct: 663 VHRRQDADHRRQDADHHRQDVVHPRQDAD 691 Score = 27.1 bits (57), Expect = 9.2 Identities = 20/70 (28%), Positives = 25/70 (35%) Frame = +2 Query: 185 VRHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDHR 364 V H R V H + H V + V +RRQDA+ + QD DH Sbjct: 634 VDHHRQDVDHHRQDADHHRQDVVHPRQDVVHRRQDADHRRQDADHHRQDVVHPRQDADHH 693 Query: 365 SPREEVLRMD 394 E R D Sbjct: 694 RQDAEHHRQD 703 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 28.3 bits (60), Expect = 4.0 Identities = 20/57 (35%), Positives = 24/57 (42%) Frame = +2 Query: 194 PRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDHR 364 PRDR + E RRR P R+ R + Y PR RR+ R R D R Sbjct: 854 PRDRRRRSPEHRRRREASPPRRDR--KRYDSPPRRRRRSPSPPPRRRRRDSYSPSRR 908 >SB_10094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 27.9 bits (59), Expect = 5.3 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +3 Query: 255 ANTVMSGGTTMYPGIADRMQKEITALAP-STIKIKIIAPPE 374 AN V+ + + +R+ KE+ L +K KIIAPPE Sbjct: 44 ANPVIHPARKVPVSLGERLDKELNRLTELGIVKEKIIAPPE 84 >SB_4199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.9 bits (59), Expect = 5.3 Identities = 18/73 (24%), Positives = 27/73 (36%) Frame = +2 Query: 188 RHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDHRS 367 RH R R + R RH RH H R++ E R+ H+ + H Sbjct: 63 RHERSRHETRQHERSRHKTSRHESSRHKTSRHGRSRHKTSRHETSRHERS-RHETRQHER 121 Query: 368 PREEVLRMDRWIH 406 R + R ++ H Sbjct: 122 SRHKTSRHEKSRH 134 Score = 27.1 bits (57), Expect = 9.2 Identities = 19/73 (26%), Positives = 26/73 (35%) Frame = +2 Query: 188 RHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDHRS 367 +H R R + RH + RH H R+ R E R+ H+ H Sbjct: 73 QHERSRHKTSRHESSRHKTSRHGRSRHKTSRHETSRHERSRHETRQHERS-RHKTSRHEK 131 Query: 368 PREEVLRMDRWIH 406 R E R +R H Sbjct: 132 SRHETSRHERSRH 144 >SB_3885| Best HMM Match : Actin (HMM E-Value=0.77) Length = 152 Score = 27.9 bits (59), Expect = 5.3 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +3 Query: 9 RXKLCYVALDFEQEM 53 + KLCYVALDF QE+ Sbjct: 92 KEKLCYVALDFYQEI 106 >SB_45720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 27.9 bits (59), Expect = 5.3 Identities = 16/67 (23%), Positives = 25/67 (37%), Gaps = 2/67 (2%) Frame = +2 Query: 215 HHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDH--RSPREEVLR 388 HHE R P + H H P ++ E P H++++ P E Sbjct: 154 HHEEEERGVHPPGQHHEEEERGVHPPGQHHEEEERGVHPPGQHHEEEERGVHPPEEHHEE 213 Query: 389 MDRWIHP 409 +R +HP Sbjct: 214 EERGVHP 220 >SB_19421| Best HMM Match : Ribosomal_L36 (HMM E-Value=0.85) Length = 647 Score = 27.9 bits (59), Expect = 5.3 Identities = 15/65 (23%), Positives = 29/65 (44%) Frame = +2 Query: 185 VRHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDHR 364 ++HP ++ H + ++ P + HHVP + +A G+ R Q+ D+ Sbjct: 550 IQHPVEKAIQHAQEKKYQP----ELEKKTIKSHHVPGQDKTEARGEERIAVWSTQNGDYY 605 Query: 365 SPREE 379 R+E Sbjct: 606 DQRDE 610 >SB_47898| Best HMM Match : Extensin_2 (HMM E-Value=0.88) Length = 490 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Frame = +2 Query: 218 HEVRRRHP*GPVRQHRHVRWYHHVP----RYRRQDAE 316 H R+H P R HR+ R + +P RY R+DA+ Sbjct: 307 HRYTRKHAKIPTRIHRYTRKHAKIPTRIHRYTRKDAK 343 Score = 27.1 bits (57), Expect = 9.2 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 5/61 (8%) Frame = +2 Query: 149 GSLPAFLP-GYGIVRHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVP----RYRRQDA 313 G++ +LP GI + + + H R+H P R HR+ R + +P RY R+ A Sbjct: 185 GNMQRYLPESIGIPGNMQRYLTRIHRYTRKHAKIPTRIHRYTRKHAKIPTRIHRYTRKHA 244 Query: 314 E 316 + Sbjct: 245 K 245 >SB_20153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +3 Query: 255 ANTVMSGGTTMYPGIADRMQKEITALAP-STIKIKIIAPPE 374 AN V+ + + +R+ KE+ L +K KIIAPPE Sbjct: 44 ANPVIHPARKVPVSLGERLDKELNHLTELGIVKEKIIAPPE 84 >SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 736 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = +2 Query: 176 YGIVRHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDH 325 Y +++PR R HH +H + H H +HH + Q H Sbjct: 247 YHKLKNPRHRYHHHHHHHHQH--NHHQHHHHHHHHHHNHHHHHQQHHHHH 294 >SB_34211| Best HMM Match : DUF1103 (HMM E-Value=6.4) Length = 126 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +2 Query: 299 RRQDAEGDHRPRALDHQDQDHRSPREEVLRMDRWIHPGFP 418 RRQ HR R D +D+D R L DR+ + +P Sbjct: 4 RRQGTATIHRYRQSDLRDRDRRRVLPRFLEQDRFDNSDYP 43 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,836,947 Number of Sequences: 59808 Number of extensions: 299968 Number of successful extensions: 1106 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 959 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1084 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -