BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31613 (411 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58485| Best HMM Match : COX2 (HMM E-Value=0) 129 8e-31 SB_14168| Best HMM Match : COX2 (HMM E-Value=0) 129 8e-31 SB_12233| Best HMM Match : COX2 (HMM E-Value=0) 78 2e-15 >SB_58485| Best HMM Match : COX2 (HMM E-Value=0) Length = 239 Score = 129 bits (312), Expect = 8e-31 Identities = 57/97 (58%), Positives = 71/97 (73%) Frame = +1 Query: 13 IEFDSYIIPSNEIKNNEFRLLDVDXXXXXXXXXXXXXXXTATDVIHS*TIPSLGVKVDAN 192 +EFDSY++P+ ++ +FRLL+VD TA DVIHS +P+L VK+DA Sbjct: 126 LEFDSYMVPTTDLNQGDFRLLEVDNRLVVPINTHVRVLITAADVIHSFAVPALAVKMDAV 185 Query: 193 PGRLNQTNFFINRPGIFFGQCSEICGANHSFIPIVIE 303 PGRLNQT FFI RPG+F+GQCSEICGANHSF+PIVIE Sbjct: 186 PGRLNQTGFFIKRPGVFYGQCSEICGANHSFMPIVIE 222 >SB_14168| Best HMM Match : COX2 (HMM E-Value=0) Length = 239 Score = 129 bits (312), Expect = 8e-31 Identities = 57/97 (58%), Positives = 71/97 (73%) Frame = +1 Query: 13 IEFDSYIIPSNEIKNNEFRLLDVDXXXXXXXXXXXXXXXTATDVIHS*TIPSLGVKVDAN 192 +EFDSY++P+ ++ +FRLL+VD TA DVIHS +P+L VK+DA Sbjct: 126 LEFDSYMVPTTDLNQGDFRLLEVDNRLVVPINTHVRVLITAADVIHSFAVPALAVKMDAV 185 Query: 193 PGRLNQTNFFINRPGIFFGQCSEICGANHSFIPIVIE 303 PGRLNQT FFI RPG+F+GQCSEICGANHSF+PIVIE Sbjct: 186 PGRLNQTGFFIKRPGVFYGQCSEICGANHSFMPIVIE 222 >SB_12233| Best HMM Match : COX2 (HMM E-Value=0) Length = 219 Score = 78.2 bits (184), Expect = 2e-15 Identities = 36/77 (46%), Positives = 48/77 (62%) Frame = +1 Query: 13 IEFDSYIIPSNEIKNNEFRLLDVDXXXXXXXXXXXXXXXTATDVIHS*TIPSLGVKVDAN 192 +EFDSY++P+ ++ +FRLL+VD TA DVIHS +P+L VK+DA Sbjct: 126 LEFDSYMVPTTDLNQGDFRLLEVDNRLVVPINTHVRVLITAADVIHSFAVPALAVKMDAV 185 Query: 193 PGRLNQTNFFINRPGIF 243 PGRLNQT FFI + F Sbjct: 186 PGRLNQTGFFIKKTWSF 202 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,700,638 Number of Sequences: 59808 Number of extensions: 151848 Number of successful extensions: 201 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 197 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 201 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 752487277 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -