BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31612 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 22 3.7 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 21 4.9 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 21 4.9 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 21 4.9 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.8 bits (44), Expect = 3.7 Identities = 10/45 (22%), Positives = 21/45 (46%) Frame = +1 Query: 370 YAGIIQLLLVTQCESLCLSFKRKLDLQMSYCXNVFSRKVSIPPMT 504 + G+ L T C+ L +S +K+ + + ++ R P+T Sbjct: 119 FGGVRDHNLTTLCQELGISVVQKVSHTLYHLQDIIDRNGGRAPLT 163 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 21.4 bits (43), Expect = 4.9 Identities = 8/26 (30%), Positives = 12/26 (46%) Frame = +3 Query: 309 YFLKHKHRYEXYNVNLSYIPVRWYHP 386 Y KH + Y +N + P Y+P Sbjct: 294 YRTDRKHTQQHYQMNQNMYPGEMYNP 319 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +2 Query: 149 SILYPHLNLHS 181 S++YPHLN S Sbjct: 242 SVMYPHLNRSS 252 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 21.4 bits (43), Expect = 4.9 Identities = 8/26 (30%), Positives = 12/26 (46%) Frame = +3 Query: 309 YFLKHKHRYEXYNVNLSYIPVRWYHP 386 Y KH + Y +N + P Y+P Sbjct: 242 YRTDRKHTQQHYQMNQNMYPGEMYNP 267 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +2 Query: 149 SILYPHLNLHS 181 S++YPHLN S Sbjct: 190 SVMYPHLNRSS 200 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 21.4 bits (43), Expect = 4.9 Identities = 8/26 (30%), Positives = 12/26 (46%) Frame = +3 Query: 309 YFLKHKHRYEXYNVNLSYIPVRWYHP 386 Y KH + Y +N + P Y+P Sbjct: 425 YRTDRKHTQQHYQMNQNMYPGEMYNP 450 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +2 Query: 149 SILYPHLNLHS 181 S++YPHLN S Sbjct: 373 SVMYPHLNRSS 383 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,163 Number of Sequences: 336 Number of extensions: 2206 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -