Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= epV31610
(516 letters)
Database: nematostella
59,808 sequences; 16,821,457 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14
SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14
SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 33 0.14
SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14
SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 33 0.14
SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 33 0.14
SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14
SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14
SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14
SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 33 0.14
SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14
SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14
SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 33 0.14
SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14
SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 33 0.14
SB_57834| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32
SB_46682| Best HMM Match : Fibrinogen_C (HMM E-Value=0.022) 31 0.43
SB_34070| Best HMM Match : Mucin (HMM E-Value=5.8) 29 1.7
SB_11312| Best HMM Match : Ank (HMM E-Value=2.1e-18) 29 2.3
SB_9222| Best HMM Match : 7tm_1 (HMM E-Value=4.1e-06) 29 2.3
SB_33861| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0
SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 29 3.0
SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0
SB_25844| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0
SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) 28 4.0
SB_3330| Best HMM Match : RBM1CTR (HMM E-Value=0.62) 28 4.0
SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 28 5.3
SB_11166| Best HMM Match : CARD (HMM E-Value=0.001) 28 5.3
SB_54983| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9
SB_23698| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9
SB_3924| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) 27 6.9
SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 27 9.2
SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 27 9.2
SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 27 9.2
SB_57201| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_55207| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 27 9.2
SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 27 9.2
SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 27 9.2
SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 27 9.2
SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 27 9.2
SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 27 9.2
SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 27 9.2
SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 27 9.2
SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 27 9.2
SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 27 9.2
SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 27 9.2
SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 27 9.2
SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 27 9.2
SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 27 9.2
SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 27 9.2
SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 27 9.2
SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 27 9.2
SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 27 9.2
SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 27 9.2
SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 27 9.2
SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 27 9.2
SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 27 9.2
SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 27 9.2
SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 27 9.2
SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 27 9.2
SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_31314| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_31029| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 27 9.2
SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 27 9.2
SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 27 9.2
SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 27 9.2
SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 27 9.2
SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 27 9.2
SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 27 9.2
SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_24636| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_23287| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 27 9.2
SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_22377| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 27 9.2
SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_21996| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_21918| Best HMM Match : STT3 (HMM E-Value=0) 27 9.2
SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32) 27 9.2
SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_21560| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 27 9.2
SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_20759| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_20660| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_20556| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_20335| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_20328| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 27 9.2
SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 27 9.2
SB_19740| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_19737| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_19732| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_19598| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 27 9.2
SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_17561| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_17455| Best HMM Match : Ank (HMM E-Value=2.2) 27 9.2
SB_17363| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_17297| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_17013| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 27 9.2
SB_16122| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_15827| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_15736| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_15584| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) 27 9.2
SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_14827| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.8) 27 9.2
SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 27 9.2
SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_14253| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 27 9.2
SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_13737| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_13672| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_13401| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 27 9.2
SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_13197| Best HMM Match : DUF765 (HMM E-Value=5.8) 27 9.2
SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_13059| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 27 9.2
SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 27 9.2
SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_12682| Best HMM Match : DUF1336 (HMM E-Value=3.2) 27 9.2
SB_12508| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_12176| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_11959| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_11796| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_11690| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_11016| Best HMM Match : DUF726 (HMM E-Value=1.3e-08) 27 9.2
SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_10507| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-09) 27 9.2
SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_9919| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 27 9.2
SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 27 9.2
SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_8043| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_7679| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 27 9.2
SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_7304| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 27 9.2
SB_7027| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_6958| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_5084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_4603| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 27 9.2
SB_4554| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_4385| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_4363| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_4332| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 27 9.2
SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 27 9.2
SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_3391| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06) 27 9.2
SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_2377| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_2289| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_2177| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_1887| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_1459| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_1407| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_1055| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_931| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2
SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) 27 9.2
>SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 408
Score = 33.1 bits (72), Expect = 0.14
Identities = 11/11 (100%), Positives = 11/11 (100%)
Frame = -2
Query: 515 NCNTTHYRANW 483
NCNTTHYRANW
Sbjct: 14 NCNTTHYRANW 24
>SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 287
Score = 33.1 bits (72), Expect = 0.14
Identities = 11/11 (100%), Positives = 11/11 (100%)
Frame = -2
Query: 515 NCNTTHYRANW 483
NCNTTHYRANW
Sbjct: 70 NCNTTHYRANW 80
>SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)
Length = 2506
Score = 33.1 bits (72), Expect = 0.14
Identities = 11/11 (100%), Positives = 11/11 (100%)
Frame = -2
Query: 515 NCNTTHYRANW 483
NCNTTHYRANW
Sbjct: 638 NCNTTHYRANW 648
>SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 63
Score = 33.1 bits (72), Expect = 0.14
Identities = 11/11 (100%), Positives = 11/11 (100%)
Frame = -2
Query: 515 NCNTTHYRANW 483
NCNTTHYRANW
Sbjct: 49 NCNTTHYRANW 59
>SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37)
Length = 257
Score = 33.1 bits (72), Expect = 0.14
Identities = 11/11 (100%), Positives = 11/11 (100%)
Frame = -2
Query: 515 NCNTTHYRANW 483
NCNTTHYRANW
Sbjct: 11 NCNTTHYRANW 21
>SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4)
Length = 117
Score = 33.1 bits (72), Expect = 0.14
Identities = 11/11 (100%), Positives = 11/11 (100%)
Frame = -2
Query: 515 NCNTTHYRANW 483
NCNTTHYRANW
Sbjct: 51 NCNTTHYRANW 61
>SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 1907
Score = 33.1 bits (72), Expect = 0.14
Identities = 11/11 (100%), Positives = 11/11 (100%)
Frame = -2
Query: 515 NCNTTHYRANW 483
NCNTTHYRANW
Sbjct: 1889 NCNTTHYRANW 1899
>SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 206
Score = 33.1 bits (72), Expect = 0.14
Identities = 11/11 (100%), Positives = 11/11 (100%)
Frame = -2
Query: 515 NCNTTHYRANW 483
NCNTTHYRANW
Sbjct: 49 NCNTTHYRANW 59
>SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 204
Score = 33.1 bits (72), Expect = 0.14
Identities = 11/11 (100%), Positives = 11/11 (100%)
Frame = -2
Query: 515 NCNTTHYRANW 483
NCNTTHYRANW
Sbjct: 11 NCNTTHYRANW 21
>SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40)
Length = 768
Score = 33.1 bits (72), Expect = 0.14
Identities = 11/11 (100%), Positives = 11/11 (100%)
Frame = -2
Query: 515 NCNTTHYRANW 483
NCNTTHYRANW
Sbjct: 43 NCNTTHYRANW 53
>SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 602
Score = 33.1 bits (72), Expect = 0.14
Identities = 11/11 (100%), Positives = 11/11 (100%)
Frame = -2
Query: 515 NCNTTHYRANW 483
NCNTTHYRANW
Sbjct: 92 NCNTTHYRANW 102
>SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 119
Score = 33.1 bits (72), Expect = 0.14
Identities = 11/11 (100%), Positives = 11/11 (100%)
Frame = -2
Query: 515 NCNTTHYRANW 483
NCNTTHYRANW
Sbjct: 70 NCNTTHYRANW 80
>SB_10526| Best HMM Match : CUE (HMM E-Value=6.5)
Length = 281
Score = 33.1 bits (72), Expect = 0.14
Identities = 11/11 (100%), Positives = 11/11 (100%)
Frame = -2
Query: 515 NCNTTHYRANW 483
NCNTTHYRANW
Sbjct: 81 NCNTTHYRANW 91
>SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 197
Score = 33.1 bits (72), Expect = 0.14
Identities = 11/11 (100%), Positives = 11/11 (100%)
Frame = -2
Query: 515 NCNTTHYRANW 483
NCNTTHYRANW
Sbjct: 57 NCNTTHYRANW 67
>SB_4159| Best HMM Match : Vpu (HMM E-Value=2)
Length = 779
Score = 33.1 bits (72), Expect = 0.14
Identities = 11/11 (100%), Positives = 11/11 (100%)
Frame = -2
Query: 515 NCNTTHYRANW 483
NCNTTHYRANW
Sbjct: 81 NCNTTHYRANW 91
>SB_57834| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 231
Score = 31.9 bits (69), Expect = 0.32
Identities = 18/49 (36%), Positives = 24/49 (48%)
Frame = +1
Query: 232 ENKILAEEAGKVENVGTENEGIKVKGFYEYVGPDGVTYRVDYTADENGF 378
EN L + GK + + + I G+YEY GP + RV AD GF
Sbjct: 154 ENSTLTQNCGKW-GISSSSVEINRWGYYEYTGPKRMYARVIVWADHLGF 201
>SB_46682| Best HMM Match : Fibrinogen_C (HMM E-Value=0.022)
Length = 395
Score = 31.5 bits (68), Expect = 0.43
Identities = 17/52 (32%), Positives = 26/52 (50%)
Frame = +1
Query: 223 YETENKILAEEAGKVENVGTENEGIKVKGFYEYVGPDGVTYRVDYTADENGF 378
+ ++N L + GK + + + I G+YEY GP + RV AD GF
Sbjct: 315 FTSKNSTLTQNCGKW-GISSSSVEINRWGYYEYTGPKRMYARVIVWADHLGF 365
>SB_34070| Best HMM Match : Mucin (HMM E-Value=5.8)
Length = 541
Score = 29.5 bits (63), Expect = 1.7
Identities = 19/43 (44%), Positives = 24/43 (55%)
Frame = +2
Query: 203 PKATTTCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAP 331
PK T TRP+TR + R +T PKTK S+S+ T T P
Sbjct: 270 PK-TRPKTRPKTRPKTRPKTRPKT-RPKTK-SKSKSKTKTATP 309
>SB_11312| Best HMM Match : Ank (HMM E-Value=2.1e-18)
Length = 516
Score = 29.1 bits (62), Expect = 2.3
Identities = 16/61 (26%), Positives = 25/61 (40%)
Frame = +1
Query: 97 SKVVTPTYVASKVVPPSGAGYDYKYGIIRYDNDVAPEGYHYLYETENKILAEEAGKVENV 276
+ ++ P V +K P G DY Y + D +A YH L E +E++
Sbjct: 183 ANIIAPISVVNKF--PPGTVVDYAYNVFYQDRKIAHTPYHALTVGERDCYNARRDMLEHL 240
Query: 277 G 279
G
Sbjct: 241 G 241
>SB_9222| Best HMM Match : 7tm_1 (HMM E-Value=4.1e-06)
Length = 425
Score = 29.1 bits (62), Expect = 2.3
Identities = 9/23 (39%), Positives = 14/23 (60%)
Frame = -1
Query: 123 NVCGCDHLAGNVCGCDWHGNGRL 55
N GC+ GN GC++ G+ R+
Sbjct: 382 NTMGCEFQGGNTMGCEFQGDSRI 404
>SB_33861| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 1205
Score = 28.7 bits (61), Expect = 3.0
Identities = 21/70 (30%), Positives = 32/70 (45%)
Frame = +1
Query: 175 IIRYDNDVAPEGYHYLYETENKILAEEAGKVENVGTENEGIKVKGFYEYVGPDGVTYRVD 354
I+RYD + P Y E++I E K +++ G+ GF+E +G D
Sbjct: 491 IVRYDRNKVPSLYQLFKFIESRIEFELRTKHKSIFGYALGVIFAGFFEGIGMFKPKLG-D 549
Query: 355 YTADENGFVA 384
+ENG VA
Sbjct: 550 SKLNENGHVA 559
>SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6)
Length = 237
Score = 28.7 bits (61), Expect = 3.0
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -2
Query: 515 NCNTTHYRAN 486
NCNTTHYRAN
Sbjct: 88 NCNTTHYRAN 97
>SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 73
Score = 28.7 bits (61), Expect = 3.0
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -2
Query: 515 NCNTTHYRAN 486
NCNTTHYRAN
Sbjct: 31 NCNTTHYRAN 40
>SB_25844| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 497
Score = 28.3 bits (60), Expect = 4.0
Identities = 16/43 (37%), Positives = 20/43 (46%)
Frame = -1
Query: 132 LAGNVCGCDHLAGNVCGCDWHGNGRLHDGQGNNAGSLVSITKV 4
L GN CG L GN CG +GN GN +G+ + V
Sbjct: 238 LYGNKCGTS-LYGNKCGTSLYGNKSGTSLYGNKSGNPPDVVAV 279
>SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23)
Length = 877
Score = 28.3 bits (60), Expect = 4.0
Identities = 16/32 (50%), Positives = 18/32 (56%), Gaps = 5/32 (15%)
Frame = -1
Query: 117 CG-CD---HLAGNVCGCDWHGNGRL-HDGQGN 37
CG CD AG V CDW G+G L D +GN
Sbjct: 667 CGPCDVAVDSAGRVIACDWSGDGVLVFDSRGN 698
>SB_3330| Best HMM Match : RBM1CTR (HMM E-Value=0.62)
Length = 546
Score = 28.3 bits (60), Expect = 4.0
Identities = 18/41 (43%), Positives = 23/41 (56%)
Frame = +2
Query: 215 TTCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAPTV 337
T T R R+ + P RS L P+ +ASRSRD APT+
Sbjct: 262 TELTERRKRYFVS-PLRSSCLWPRGRASRSRD--GACAPTM 299
>SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8)
Length = 142
Score = 27.9 bits (59), Expect = 5.3
Identities = 15/18 (83%), Positives = 15/18 (83%)
Frame = +3
Query: 462 TRGGARYPIRPIVSRITI 515
T GGA PIRPIVSRITI
Sbjct: 34 TDGGA--PIRPIVSRITI 49
>SB_11166| Best HMM Match : CARD (HMM E-Value=0.001)
Length = 720
Score = 27.9 bits (59), Expect = 5.3
Identities = 18/40 (45%), Positives = 21/40 (52%), Gaps = 11/40 (27%)
Frame = +2
Query: 428 FKVILEKKKKKNSRGG-------PVP----NSPYSESYYN 514
F + L KK++ N G P P NSPYSESYYN
Sbjct: 588 FLISLPKKRRSNINPGDPLVLERPPPRWSSNSPYSESYYN 627
>SB_54983| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 132
Score = 27.5 bits (58), Expect = 6.9
Identities = 11/27 (40%), Positives = 17/27 (62%)
Frame = +2
Query: 230 PRTRFSLKKPARSRTLAPKTKASRSRD 310
P+T+ KP +R + KTK SR++D
Sbjct: 25 PKTKTKTSKPQAARQASRKTKTSRTQD 51
>SB_23698| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 964
Score = 27.5 bits (58), Expect = 6.9
Identities = 13/32 (40%), Positives = 18/32 (56%)
Frame = +2
Query: 218 TCTRPRTRFSLKKPARSRTLAPKTKASRSRDS 313
TC R + SL P+ S + +P A+R RDS
Sbjct: 44 TCPHCRAKASLPSPSPSPSPSPSQGATRERDS 75
>SB_3924| Best HMM Match : E-MAP-115 (HMM E-Value=4.2)
Length = 344
Score = 27.5 bits (58), Expect = 6.9
Identities = 13/33 (39%), Positives = 20/33 (60%)
Frame = +2
Query: 230 PRTRFSLKKPARSRTLAPKTKASRSRDSTNTLA 328
P+T+ + KPAR R +PK K S+ +D +A
Sbjct: 289 PKTKST--KPARPRQASPKAKTSKPQDQDKQVA 319
>SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 119
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 134
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 33 NSPYSESYYN 42
>SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 133
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 31 NSPYSESYYN 40
>SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 158
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 56 NSPYSESYYN 65
>SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 149
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 47 NSPYSESYYN 56
>SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 126
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 24 NSPYSESYYN 33
>SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 141
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 39 NSPYSESYYN 48
>SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 150
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 48 NSPYSESYYN 57
>SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 131
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 29 NSPYSESYYN 38
>SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12)
Length = 297
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 205 NSPYSESYYN 214
>SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 202
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 100 NSPYSESYYN 109
>SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 138
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 36 NSPYSESYYN 45
>SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69)
Length = 472
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 370 NSPYSESYYN 379
>SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 119
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 130
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 28 NSPYSESYYN 37
>SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1)
Length = 129
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 27 NSPYSESYYN 36
>SB_57201| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 221
Score = 27.1 bits (57), Expect = 9.2
Identities = 11/18 (61%), Positives = 15/18 (83%)
Frame = +2
Query: 272 TLAPKTKASRSRDSTNTL 325
T+APKTK SR+ +TNT+
Sbjct: 11 TMAPKTKCSRATMATNTV 28
>SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 136
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 34 NSPYSESYYN 43
>SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 431
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 329 NSPYSESYYN 338
>SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 171
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 69 NSPYSESYYN 78
>SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 141
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 39 NSPYSESYYN 48
>SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 150
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 48 NSPYSESYYN 57
>SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 134
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 32 NSPYSESYYN 41
>SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 225
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 123 NSPYSESYYN 132
>SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 154
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 52 NSPYSESYYN 61
>SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 130
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 28 NSPYSESYYN 37
>SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 158
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 56 NSPYSESYYN 65
>SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 539
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 245 NSPYSESYYN 254
>SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 127
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 25 NSPYSESYYN 34
>SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 205
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 103 NSPYSESYYN 112
>SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 125
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 23 NSPYSESYYN 32
>SB_55207| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 119
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 487
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 385 NSPYSESYYN 394
>SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 269
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 108 NSPYSESYYN 117
>SB_54473| Best HMM Match : DLIC (HMM E-Value=0)
Length = 1401
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 403 NSPYSESYYN 412
>SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 147
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 45 NSPYSESYYN 54
>SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6)
Length = 137
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 35 NSPYSESYYN 44
>SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 145
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 43 NSPYSESYYN 52
>SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 154
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 52 NSPYSESYYN 61
>SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 300
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 174 NSPYSESYYN 183
>SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 125
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 23 NSPYSESYYN 32
>SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 131
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 29 NSPYSESYYN 38
>SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 145
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 43 NSPYSESYYN 52
>SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6)
Length = 142
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 40 NSPYSESYYN 49
>SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 126
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 24 NSPYSESYYN 33
>SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 140
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 38 NSPYSESYYN 47
>SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 130
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 28 NSPYSESYYN 37
>SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 110
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 174
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 73 NSPYSESYYN 82
>SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29)
Length = 473
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 329 NSPYSESYYN 338
>SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 119
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 119
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 177
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 75 NSPYSESYYN 84
>SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 127
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 25 NSPYSESYYN 34
>SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20)
Length = 385
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 283 NSPYSESYYN 292
>SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 148
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 46 NSPYSESYYN 55
>SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 857
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 400 NSPYSESYYN 409
>SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 142
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 40 NSPYSESYYN 49
>SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 133
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 32 NSPYSESYYN 41
>SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 184
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 82 NSPYSESYYN 91
>SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 302
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 200 NSPYSESYYN 209
>SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 134
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 32 NSPYSESYYN 41
>SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 133
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 32 NSPYSESYYN 41
>SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 142
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 40 NSPYSESYYN 49
>SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 136
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 34 NSPYSESYYN 43
>SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 125
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 24 NSPYSESYYN 33
>SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1)
Length = 286
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 184 NSPYSESYYN 193
>SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8)
Length = 143
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 41 NSPYSESYYN 50
>SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 143
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 42 NSPYSESYYN 51
>SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 237
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 75 NSPYSESYYN 84
>SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 119
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 140
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 38 NSPYSESYYN 47
>SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4)
Length = 325
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 176 NSPYSESYYN 185
>SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 158
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 56 NSPYSESYYN 65
>SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 141
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 39 NSPYSESYYN 48
>SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 167
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 65 NSPYSESYYN 74
>SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 187
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 85 NSPYSESYYN 94
>SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 103
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 29 NSPYSESYYN 38
>SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 140
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 38 NSPYSESYYN 47
>SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 754
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 652 NSPYSESYYN 661
>SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5)
Length = 139
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 37 NSPYSESYYN 46
>SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 128
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 26 NSPYSESYYN 35
>SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 127
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 25 NSPYSESYYN 34
>SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4)
Length = 134
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 32 NSPYSESYYN 41
>SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 171
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 69 NSPYSESYYN 78
>SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 121
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 19 NSPYSESYYN 28
>SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 136
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 34 NSPYSESYYN 43
>SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 236
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 134 NSPYSESYYN 143
>SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0)
Length = 496
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 64 NSPYSESYYN 73
>SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 119
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023)
Length = 1016
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 914 NSPYSESYYN 923
>SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 137
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 35 NSPYSESYYN 44
>SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 148
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 46 NSPYSESYYN 55
>SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 119
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 136
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 35 NSPYSESYYN 44
>SB_44259| Best HMM Match : MORN (HMM E-Value=3.7)
Length = 718
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 342 NSPYSESYYN 351
>SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56)
Length = 166
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 64 NSPYSESYYN 73
>SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 217
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 115 NSPYSESYYN 124
>SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 188
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 86 NSPYSESYYN 95
>SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 145
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 43 NSPYSESYYN 52
>SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 195
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 93 NSPYSESYYN 102
>SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 138
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 36 NSPYSESYYN 45
>SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016)
Length = 999
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 897 NSPYSESYYN 906
>SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8)
Length = 130
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 28 NSPYSESYYN 37
>SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 134
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 32 NSPYSESYYN 41
>SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 186
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 84 NSPYSESYYN 93
>SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 197
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 70 NSPYSESYYN 79
>SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 128
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 26 NSPYSESYYN 35
>SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 147
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 45 NSPYSESYYN 54
>SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 141
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 39 NSPYSESYYN 48
>SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 143
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 41 NSPYSESYYN 50
>SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 186
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 85 NSPYSESYYN 94
>SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 166
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 64 NSPYSESYYN 73
>SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 149
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 47 NSPYSESYYN 56
>SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 162
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 60 NSPYSESYYN 69
>SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 138
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 36 NSPYSESYYN 45
>SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 144
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 42 NSPYSESYYN 51
>SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 147
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 45 NSPYSESYYN 54
>SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 203
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 101 NSPYSESYYN 110
>SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 152
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 51 NSPYSESYYN 60
>SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 164
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 62 NSPYSESYYN 71
>SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 126
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 24 NSPYSESYYN 33
>SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 119
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 916
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 814 NSPYSESYYN 823
>SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 163
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 61 NSPYSESYYN 70
>SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 148
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 46 NSPYSESYYN 55
>SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016)
Length = 872
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 770 NSPYSESYYN 779
>SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 137
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 36 NSPYSESYYN 45
>SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21)
Length = 372
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 60 NSPYSESYYN 69
>SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034)
Length = 265
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 163 NSPYSESYYN 172
>SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016)
Length = 606
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 504 NSPYSESYYN 513
>SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 125
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 23 NSPYSESYYN 32
>SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 158
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 56 NSPYSESYYN 65
>SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36)
Length = 1290
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 31 NSPYSESYYN 40
>SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 204
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 102 NSPYSESYYN 111
>SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 159
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 57 NSPYSESYYN 66
>SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 184
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 82 NSPYSESYYN 91
>SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 147
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 45 NSPYSESYYN 54
>SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2)
Length = 352
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 174 NSPYSESYYN 183
>SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 127
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 25 NSPYSESYYN 34
>SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 127
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 25 NSPYSESYYN 34
>SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 177
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 75 NSPYSESYYN 84
>SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 119
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 130
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 28 NSPYSESYYN 37
>SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 125
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 23 NSPYSESYYN 32
>SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15)
Length = 783
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 545 NSPYSESYYN 554
>SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 146
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 44 NSPYSESYYN 53
>SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 145
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 43 NSPYSESYYN 52
>SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 147
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 45 NSPYSESYYN 54
>SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 157
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 55 NSPYSESYYN 64
>SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 119
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 779
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 450 NSPYSESYYN 459
>SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
>SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 125
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 23 NSPYSESYYN 32
>SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 120
Score = 27.1 bits (57), Expect = 9.2
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 485 NSPYSESYYN 514
NSPYSESYYN
Sbjct: 18 NSPYSESYYN 27
Database: nematostella
Posted date: Oct 22, 2007 1:22 PM
Number of letters in database: 16,821,457
Number of sequences in database: 59,808
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,664,096
Number of Sequences: 59808
Number of extensions: 237603
Number of successful extensions: 2315
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 2162
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2311
length of database: 16,821,457
effective HSP length: 77
effective length of database: 12,216,241
effective search space used: 1148326654
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -