BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31610 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 52 5e-09 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 7.5 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 7.5 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 7.5 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 7.5 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 7.5 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 51.6 bits (118), Expect = 5e-09 Identities = 33/88 (37%), Positives = 44/88 (50%), Gaps = 1/88 (1%) Frame = +1 Query: 142 PSGAGYDYKYGIIRYDNDVAPEG-YHYLYETENKILAEEAGKVENVGTENEGIKVKGFYE 318 PSG G D I +V +G Y +ET N I +E+G+ + V E + +G Sbjct: 19 PSG-GADKDAVITSQQLEVNFDGNYINNFETSNGISHQESGQPKQVDNETPVVS-QGSDS 76 Query: 319 YVGPDGVTYRVDYTADENGFVADGAHIP 402 Y PDG + Y ADENGF G+HIP Sbjct: 77 YTAPDGQQVSITYVADENGFQVQGSHIP 104 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -1 Query: 54 HDGQGNNAGSLVSITKV 4 H G G N G + ITK+ Sbjct: 148 HTGVGRNVGYKIPITKL 164 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -1 Query: 54 HDGQGNNAGSLVSITKV 4 H G G N G + ITK+ Sbjct: 148 HTGVGRNVGYKIPITKL 164 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -1 Query: 54 HDGQGNNAGSLVSITKV 4 H G G N G + ITK+ Sbjct: 148 HTGVGRNVGYKIPITKL 164 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 300 LDAFVFGANVLDLAG 256 L AF+FGAN L G Sbjct: 53 LSAFLFGANALFTPG 67 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 Query: 431 KVILEKKKKKNSRGGPVPN 487 K+I EK+K KN P N Sbjct: 462 KIIEEKRKNKNKNLTPAVN 480 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,247 Number of Sequences: 438 Number of extensions: 2040 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -