BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31602 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_1270 + 27466516-27466621,27466722-27466885,27467385-274681... 29 2.2 09_04_0244 - 15984862-15984978,15985054-15985119,15985701-159857... 28 3.9 02_05_1341 - 35801987-35802472 27 6.8 04_04_0576 + 26346611-26346637,26346758-26346883,26347161-263472... 27 8.9 >12_02_1270 + 27466516-27466621,27466722-27466885,27467385-27468173, 27468263-27468479,27469078-27469256,27470233-27470474, 27470607-27470994 Length = 694 Score = 29.1 bits (62), Expect = 2.2 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -3 Query: 235 CKIYSTELYNIKPNLRLIM*I*NIKTKLYKCKSSNGIQEY 116 C YS EL+N PN+R I + N T +S + Q+Y Sbjct: 92 CNPYSAELFNAGPNIRTIPFLCN-STSSSSAQSKDSTQDY 130 >09_04_0244 - 15984862-15984978,15985054-15985119,15985701-15985793, 15987284-15987410,15988710-15988840,15989485-15989766, 15989852-15989985,15990083-15990292,15990456-15990486 Length = 396 Score = 28.3 bits (60), Expect = 3.9 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +1 Query: 61 ATPTLEPIQDNFIIVNVLRIPVCHSMICTYIVS 159 A T+EP Q + +V + +PVC+SM+C +++ Sbjct: 150 AVVTIEP-QFDLPLVKLHDVPVCYSMLCRPVIA 181 >02_05_1341 - 35801987-35802472 Length = 161 Score = 27.5 bits (58), Expect = 6.8 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 18 CMDSCMNSDHYCPNCNAYIGTYT 86 C+D+ + + CP+C A +GT T Sbjct: 103 CIDTWLGTHATCPSCRATVGTST 125 >04_04_0576 + 26346611-26346637,26346758-26346883,26347161-26347295, 26348162-26348332 Length = 152 Score = 27.1 bits (57), Expect = 8.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 76 EPIQDNFIIVNVLRIPVCHSMICTYIVSFLY 168 E I DNF ++ R+ CH C VSF Y Sbjct: 50 EKISDNFQLIWAFRLKPCHCRKCV-CVSFYY 79 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,230,625 Number of Sequences: 37544 Number of extensions: 221765 Number of successful extensions: 473 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 473 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -