BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31601 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1B2.04 |cox6||cytochrome c oxidase subunit VI|Schizosaccharo... 72 4e-14 SPBC119.12 |||Golgi matrix protein |Schizosaccharomyces pombe|ch... 25 8.9 >SPAC1B2.04 |cox6||cytochrome c oxidase subunit VI|Schizosaccharomyces pombe|chr 1|||Manual Length = 140 Score = 72.1 bits (169), Expect = 4e-14 Identities = 38/97 (39%), Positives = 56/97 (57%) Frame = +2 Query: 155 EEFDNRYEAYFNRKDIDGWEIRKGMNDLCGMDLVPDPKIIKAALHACRRVNDYALAVRFI 334 EE + +Y +F+ D +E+++G+N+ D+VP +I+ AL A RRVND+ AVR Sbjct: 45 EEINTKYNDFFSNVQ-DQFELQRGLNNCFAYDIVPSSDVIEQALRAARRVNDFPTAVRIF 103 Query: 335 EACKDKCGNKVNEIYPYIIQEIKPTLTELGIDTPEEL 445 E K K K E Y ++E+KP ELGI E+L Sbjct: 104 EGIKVKLPTK--EQYQAYVKELKPVCNELGIVLKEDL 138 >SPBC119.12 |||Golgi matrix protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 401 Score = 24.6 bits (51), Expect = 8.9 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +3 Query: 165 ITDMKHISTEKTLMVGKSAKE 227 ++D++H EKTL++GK E Sbjct: 276 VSDLEHEVKEKTLLIGKLQHE 296 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,144,120 Number of Sequences: 5004 Number of extensions: 43660 Number of successful extensions: 104 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -