BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31601 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g51540.1 68414.m05801 kelch repeat-containing protein contain... 30 1.1 At1g24480.1 68414.m03083 hypothetical protein 29 2.5 At5g42170.1 68418.m05133 family II extracellular lipase, putativ... 28 3.2 At4g19090.1 68417.m02814 hypothetical protein contains Pfam doma... 28 3.2 At2g01050.1 68415.m00010 hypothetical protein 28 4.3 At5g10690.1 68418.m01237 pentatricopeptide (PPR) repeat-containi... 27 5.7 At3g20270.1 68416.m02567 lipid-binding serum glycoprotein family... 27 5.7 At2g37730.1 68415.m04627 fringe-related protein similarity to pr... 27 7.5 At1g54940.1 68414.m06274 glycogenin glucosyltransferase (glycoge... 27 7.5 At1g09620.1 68414.m01079 tRNA synthetase class I (I, L, M and V)... 27 7.5 >At1g51540.1 68414.m05801 kelch repeat-containing protein contains Pfam profile PF01344: Kelch motif Length = 1036 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 5/45 (11%) Frame = +3 Query: 129 HTEVQWKVTKNSI-----TDMKHISTEKTLMVGKSAKE*MTSVVW 248 H E WKV NSI T KH T+K ++VG+ + + ++ W Sbjct: 938 HIEFAWKVVNNSIVIVGGTTEKHPETKKMVLVGEIFQFNLNTLKW 982 >At1g24480.1 68414.m03083 hypothetical protein Length = 239 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +2 Query: 218 RKGMNDLCGMDLVP-DPKIIKAALH 289 R G+ND GMDLVP P ++K H Sbjct: 113 RVGVNDSVGMDLVPYPPLVVKGDFH 137 >At5g42170.1 68418.m05133 family II extracellular lipase, putative similar to family II lipase EXL3 [Arabidopsis thaliana] GI:15054386; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 319 Score = 28.3 bits (60), Expect = 3.2 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 344 KDKCGNKVNEIYPYIIQEIKPTLTELGIDTPE 439 K +C K+NE+ +I PTL LG + P+ Sbjct: 202 KRRCSEKLNEVARNFNAKISPTLEALGKELPD 233 >At4g19090.1 68417.m02814 hypothetical protein contains Pfam domain, PF04578: Protein of unknown function, DUF594 Length = 751 Score = 28.3 bits (60), Expect = 3.2 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -3 Query: 451 VAKLLRCVNTQFGESRLDLLNDVWVDFI 368 +AK L+ V FGE + +L+ VW++F+ Sbjct: 687 LAKELQRVEKNFGEDKWKILSKVWLEFL 714 >At2g01050.1 68415.m00010 hypothetical protein Length = 515 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = +3 Query: 231 MTSVVWISFPTQRLSKLPFMHADESMIMPLQSGL*KPAKTNVET 362 +T+ VW+ RLS +P+ + ++M + GL +P K ++ T Sbjct: 162 VTTPVWV-----RLSNIPYNYYHRCLLMEIARGLGRPLKVDMNT 200 >At5g10690.1 68418.m01237 pentatricopeptide (PPR) repeat-containing protein / CBS domain-containing protein contains CBS and PPR domain repeats Length = 580 Score = 27.5 bits (58), Expect = 5.7 Identities = 17/65 (26%), Positives = 28/65 (43%) Frame = +2 Query: 227 MNDLCGMDLVPDPKIIKAALHACRRVNDYALAVRFIEACKDKCGNKVNEIYPYIIQEIKP 406 ++++ + L PD +HAC + D A++F K+ K E Y +Q Sbjct: 213 LDEMLRLRLEPDRLTYNTLIHACIKCGDLDAAMKFFNDMKE----KAEEYYDDFLQPDVV 268 Query: 407 TLTEL 421 T T L Sbjct: 269 TYTTL 273 >At3g20270.1 68416.m02567 lipid-binding serum glycoprotein family protein similar to SP|P17213 Bactericidal permeability-increasing protein precursor (BPI) {Homo sapiens}; contains Pfam profile PF02886: LBP / BPI / CETP family, C-terminal domain Length = 722 Score = 27.5 bits (58), Expect = 5.7 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +3 Query: 102 GSAPYLYGDHTEVQWKVTKNSITDMKHI--STEKTLMVGKSAKE*MTSVVWISFPT 263 G PY Y +VQWKV + D + + +E ++G AK ++ + S+P+ Sbjct: 184 GFLPYPYSRPIKVQWKVFEKLFVDFRDLLDHSEYCDLIG-IAKNKFQTIPYFSYPS 238 >At2g37730.1 68415.m04627 fringe-related protein similarity to predicted proteins + similar to hypothetical protein GB:AAC23643 [Arabidopsis thaliana] + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 532 Score = 27.1 bits (57), Expect = 7.5 Identities = 15/52 (28%), Positives = 30/52 (57%) Frame = +2 Query: 311 YALAVRFIEACKDKCGNKVNEIYPYIIQEIKPTLTELGIDTPEELGYDKPEL 466 Y LAV ++ D C ++ +Y Q+I+ L+E+G+ +ELG+ + ++ Sbjct: 249 YPLAVELVKLL-DGCIDRYASLYGSD-QKIEACLSEIGVPLTKELGFHQVDI 298 >At1g54940.1 68414.m06274 glycogenin glucosyltransferase (glycogenin)-related contains similarity to glycogenin-1 from Mus musculus [SP|Q9R062], Rattus norvegicus [SP|O08730], Homo sapiens [SP|P46976] Length = 557 Score = 27.1 bits (57), Expect = 7.5 Identities = 20/81 (24%), Positives = 35/81 (43%) Frame = +2 Query: 140 PVESDEEFDNRYEAYFNRKDIDGWEIRKGMNDLCGMDLVPDPKIIKAALHACRRVNDYAL 319 P+ E D + R DGW KG+ D+ + + + A+ + R + A+ Sbjct: 130 PLPQPEGSDANVDVIVARVPCDGWSANKGLRDVFRLQV--NLAAANLAVQSGLRTVNQAV 187 Query: 320 AVRFIEACKDKCGNKVNEIYP 382 V FI +C ++EI+P Sbjct: 188 YVVFIGSC-----GPMHEIFP 203 >At1g09620.1 68414.m01079 tRNA synthetase class I (I, L, M and V) family protein similar to cytosolic leucyl-tRNA synthetase [Candida albicans] GI:9858190; contains Pfam profile PF00133: tRNA synthetases class I (I, L, M and V) Length = 1084 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 365 VNEIYPYIIQEIKPTLTELGIDTPEELGYDKPE 463 + E + +QEIKP + I+T E + Y +PE Sbjct: 482 IGEFFGRKVQEIKPIIKTKLIETGEAIIYSEPE 514 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,136,187 Number of Sequences: 28952 Number of extensions: 228692 Number of successful extensions: 621 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 621 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -