BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31599 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11465| Best HMM Match : EGF (HMM E-Value=0.13) 31 0.43 SB_33144| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 >SB_11465| Best HMM Match : EGF (HMM E-Value=0.13) Length = 695 Score = 31.5 bits (68), Expect = 0.43 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 213 CLSYPCHENPACRLRDKK 160 C+S PCHE CRL D+K Sbjct: 163 CVSNPCHEGATCRLLDEK 180 >SB_33144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 563 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 265 AYFHYKSAPERKVFEISLPIVSVPR--KPCLPTP 170 AYF ++A E+K S+P+ VP P PTP Sbjct: 375 AYFRQQAAKEQKAASTSMPVKKVPAPVSPAQPTP 408 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,036,899 Number of Sequences: 59808 Number of extensions: 233353 Number of successful extensions: 412 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 386 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 412 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -