BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31599 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 25 1.5 AJ302658-1|CAC35523.1| 145|Anopheles gambiae gSG7 protein protein. 23 4.6 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 8.1 AF457561-1|AAL68791.1| 46|Anopheles gambiae hypothetical prote... 23 8.1 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 25.0 bits (52), Expect = 1.5 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +3 Query: 297 VFFCKSTFFI*CLKSYSAKINLSL*YIKYCVNFKIT 404 VF+C S FI C +++ A + L + + +N +T Sbjct: 344 VFYCMSLLFIICNEAHHASKRVGLNFQERLLNVNLT 379 >AJ302658-1|CAC35523.1| 145|Anopheles gambiae gSG7 protein protein. Length = 145 Score = 23.4 bits (48), Expect = 4.6 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 125 NNCLQCLIFRCIFLSRSRQAGFSWHGYDRQRY 220 + CL+ ++ R L S A FS++ +D +Y Sbjct: 83 DGCLKQMVARVTDLEASFYASFSYNCHDHDQY 114 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.6 bits (46), Expect = 8.1 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = +2 Query: 134 LQCLIFRCIFLSRSRQAGFSW 196 L + RC+F+S ++ G W Sbjct: 383 LDVAVLRCLFISHWQEEGVYW 403 >AF457561-1|AAL68791.1| 46|Anopheles gambiae hypothetical protein 14 protein. Length = 46 Score = 22.6 bits (46), Expect = 8.1 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 73 VPLNYCSLNLTH 38 +PL+YC L LTH Sbjct: 1 MPLSYCHLFLTH 12 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 469,350 Number of Sequences: 2352 Number of extensions: 8997 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -