BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31596 (473 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC30B4.06c |||tRNA uridine 5-carboxymethylaminomethyl modifica... 28 0.63 SPBC115.03 ||SPBC839.18c|gfo/idh/mocA family oxidoreductase |Sch... 25 4.5 SPCC737.03c |||conserved eukaryotic protein|Schizosaccharomyces ... 25 7.8 >SPBC30B4.06c |||tRNA uridine 5-carboxymethylaminomethyl modification enzyme|Schizosaccharomyces pombe|chr 2|||Manual Length = 666 Score = 28.3 bits (60), Expect = 0.63 Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = +1 Query: 160 LDPNAWWGPE--XHEIPQ*YQHTTLLRSV 240 LDPN+WW P + +P+ QH ++RS+ Sbjct: 319 LDPNSWWYPNGLSNSMPEEIQH-NIIRSI 346 >SPBC115.03 ||SPBC839.18c|gfo/idh/mocA family oxidoreductase |Schizosaccharomyces pombe|chr 2|||Manual Length = 368 Score = 25.4 bits (53), Expect = 4.5 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +1 Query: 304 PLXGIGXEYGXNSNILGWLASILGRRVXL*XKGNILEQIPPI 429 P G G YG S+++ S+ G + K QIPP+ Sbjct: 172 PRPGNGMVYGIGSHLIDQAVSLFGTPYSVTAKLEAQRQIPPL 213 >SPCC737.03c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 615 Score = 24.6 bits (51), Expect = 7.8 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +1 Query: 355 WLASILGRRVXL*XKGNILEQIPPICDQHTGIG 453 W SI + KG+IL+ PP Q G+G Sbjct: 46 WTCSICEATNHIDEKGDILDYRPPTPTQDKGVG 78 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,782,817 Number of Sequences: 5004 Number of extensions: 29142 Number of successful extensions: 62 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 182448900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -