BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31596 (473 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0566 + 4466318-4466695,4466736-4466909,4466941-4467038,446... 28 4.4 07_03_1345 + 25919379-25920866,25921342-25921962,25922733-259228... 27 5.8 03_01_0438 + 3399203-3399297,3399389-3399480,3399638-3399750,340... 27 5.8 03_04_0228 - 18989688-18989807,18990300-18990345,18990452-189905... 27 7.7 02_05_1297 - 35536193-35536312,35536405-35536467,35536610-355369... 27 7.7 >11_01_0566 + 4466318-4466695,4466736-4466909,4466941-4467038, 4467211-4467346 Length = 261 Score = 27.9 bits (59), Expect = 4.4 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = +2 Query: 128 WRLKIQNQHTSWILTLGGDRKXTKYHNDTSIRP 226 W I +QH W L + G + + +H + P Sbjct: 186 WATGIHDQHMGWNLVIAGSKSLSCHHGHHQLNP 218 >07_03_1345 + 25919379-25920866,25921342-25921962,25922733-25922893, 25923284-25923422,25923509-25923592,25923944-25923982, 25924037-25924222,25924347-25924478,25924810-25925009, 25925294-25925498,25925618-25925944 Length = 1193 Score = 27.5 bits (58), Expect = 5.8 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 40 INEFDDRSWKPXMGGLFRLXVASCLTIELXASQNTEPA 153 ++ FD+RSW P LF+L C +S+N EP+ Sbjct: 867 LSAFDNRSWIPVTNILFQL----CKGFGFASSKNVEPS 900 >03_01_0438 + 3399203-3399297,3399389-3399480,3399638-3399750, 3400345-3400610,3400793-3400864,3401023-3401098, 3401241-3401339,3401432-3401586,3401679-3401783, 3401880-3401966,3402459-3402543,3402626-3402734, 3403468-3403544,3403635-3403715,3404137-3404328, 3404415-3404528,3404650-3404742,3404864-3404990, 3405075-3405151,3405455-3405502,3405588-3405657, 3405737-3405810,3405895-3406005,3406222-3406300, 3406936-3408320 Length = 1293 Score = 27.5 bits (58), Expect = 5.8 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = -1 Query: 455 CPIPVCWSHIGGICSRIFPFX*RXTLLPNIEASHPKILELXPY 327 C +P+C S+ GI +RI P T L + EA HPK + + PY Sbjct: 861 CEVPLCSSYENGI-TRI-P---EETRLRDPEAYHPKAVCIGPY 898 >03_04_0228 - 18989688-18989807,18990300-18990345,18990452-18990552, 18990624-18990702,18990788-18990868,18991440-18991502, 18994171-18994246,18994980-18995246,18995994-18996076, 18996792-18996922,18997043-18997174 Length = 392 Score = 27.1 bits (57), Expect = 7.7 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = -3 Query: 234 SQKGRMLVSLWYFVXFRSPPSVRIQLVCWFCILRRXKFYC*TRRY 100 S +GR VS+ +F S S +I +V C+LR KF C RY Sbjct: 210 SVEGR--VSMEFFDLSESAQSKKIGVVRPCCLLRSLKFVCRELRY 252 >02_05_1297 - 35536193-35536312,35536405-35536467,35536610-35536942, 35537098-35537184,35538337-35538399,35538604-35538750, 35538900-35539001,35539069-35539197,35539506-35539664, 35539726-35539967,35540317-35540506,35540692-35540907, 35541536-35541760 Length = 691 Score = 27.1 bits (57), Expect = 7.7 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -2 Query: 205 VVFRAFPVPTKR*DPTCMLVLYFETPXVLLLDK 107 V+ RAFP+P + + F+ P ++LLD+ Sbjct: 594 VLIRAFPIPGGQKSRVAFAKITFKKPHIILLDE 626 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,698,826 Number of Sequences: 37544 Number of extensions: 190990 Number of successful extensions: 346 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 342 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 346 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 967140324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -