BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31596 (473 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U64852-7|AAB04970.1| 452|Caenorhabditis elegans Hypothetical pr... 38 0.003 Z74029-6|CAM84812.1| 457|Caenorhabditis elegans Hypothetical pr... 29 1.7 >U64852-7|AAB04970.1| 452|Caenorhabditis elegans Hypothetical protein W01A11.1 protein. Length = 452 Score = 38.3 bits (85), Expect = 0.003 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +2 Query: 368 YWAEEYXFXEREIFLNKYPQYVTNIQGLDIH 460 YW +Y + ++E +N++PQ+ T I+GL +H Sbjct: 99 YWLNKYDWRKQEATINQFPQFKTEIEGLQVH 129 >Z74029-6|CAM84812.1| 457|Caenorhabditis elegans Hypothetical protein C45B11.6 protein. Length = 457 Score = 29.1 bits (62), Expect = 1.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 383 YXFXEREIFLNKYPQYVTNIQGLDIH 460 + + + + FLN + QY T I+GL IH Sbjct: 98 FNWKQHQHFLNTFKQYKTEIEGLKIH 123 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,813,170 Number of Sequences: 27780 Number of extensions: 159614 Number of successful extensions: 289 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 289 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 860942358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -