BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31596 (473 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 23 1.7 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 23 2.2 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 5.1 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 5.1 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 6.7 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 23.0 bits (47), Expect = 1.7 Identities = 10/37 (27%), Positives = 16/37 (43%) Frame = -3 Query: 303 WHGFAMIIKSISEVRYHXCHGXRSQKGRMLVSLWYFV 193 WH I K+I +R+ H R + + W +V Sbjct: 473 WHHCPEIYKAIEGIRFIADHTKREEDSTRVKEDWKYV 509 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 22.6 bits (46), Expect = 2.2 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 72 WFPTAIVEFVYF*ILLDL 19 WFP ++ + Y ILL++ Sbjct: 214 WFPLVVIIYTYTSILLEI 231 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 5.1 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 304 PLXGIGXEYGXNSNILGWLASI 369 P+ + EY S++LGWL + Sbjct: 516 PVKYLTYEYPWWSHVLGWLCGL 537 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 5.1 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 304 PLXGIGXEYGXNSNILGWLASI 369 P+ + EY S++LGWL + Sbjct: 569 PVKYLTYEYPWWSHVLGWLCGL 590 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.0 bits (42), Expect = 6.7 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -2 Query: 472 YLITMYVQSLYVGHILGVFVQEYFPF 395 Y ++ + ++ VG I+GVF+ + PF Sbjct: 263 YHVSDHKAAITVGVIMGVFLICWVPF 288 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,960 Number of Sequences: 438 Number of extensions: 2462 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12805416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -