SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV31592
         (516 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U50469-1|AAA93473.1|  160|Anopheles gambiae protein ( Anopheles ...    35   0.002

>U50469-1|AAA93473.1|  160|Anopheles gambiae protein ( Anopheles
           gambiae putativecuticle protein mRNA, partial cds. ).
          Length = 160

 Score = 34.7 bits (76), Expect = 0.002
 Identities = 18/33 (54%), Positives = 20/33 (60%), Gaps = 1/33 (3%)
 Frame = +3

Query: 285 EGIKVKGFYEYVGPDGVTYRVDYTAD-ENGFVA 380
           +G  V+G Y  V PDG    VDYTAD  NGF A
Sbjct: 45  DGDVVQGSYSVVDPDGTKRTVDYTADPHNGFNA 77


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.317    0.127    0.392 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 441,669
Number of Sequences: 2352
Number of extensions: 8325
Number of successful extensions: 16
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 46937349
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -