BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31590 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19C2.01 |cdc28|prp8|ATP-dependent RNA helicase Cdc28 |Schizo... 29 0.55 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 26 2.9 SPCC576.05 |||nucear export factor|Schizosaccharomyces pombe|chr... 26 3.8 SPAC3A11.13 ||SPAC3H5.02|prefoldin subunit 6|Schizosaccharomyces... 25 5.1 SPAP14E8.02 |||transcription factor |Schizosaccharomyces pombe|c... 25 6.7 SPBC2D10.20 |ubc1||ubiquitin conjugating enzyme Ubc1|Schizosacch... 25 6.7 SPAC31G5.19 |||ATPase with bromodomain protein|Schizosaccharomyc... 25 8.9 >SPBC19C2.01 |cdc28|prp8|ATP-dependent RNA helicase Cdc28 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1055 Score = 28.7 bits (61), Expect = 0.55 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = +1 Query: 289 DQLQDIQSVLPDMTDFKYIGTETMQDADTAKWQMVQPVGDKLNKYTMWVKYKKT 450 +++ I S+L + + Y + + +AD A+ QP GD L +W ++ T Sbjct: 857 EEVLSIVSMLGEASSLFYRPKDKIMEADKARANFTQPGGDHLTLLHIWNEWVDT 910 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 26.2 bits (55), Expect = 2.9 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 443 LYLTHIVYLFSLSPTGCT 390 +Y H+VY+ SLSP C+ Sbjct: 1399 VYAAHLVYILSLSPDVCS 1416 >SPCC576.05 |||nucear export factor|Schizosaccharomyces pombe|chr 3|||Manual Length = 1024 Score = 25.8 bits (54), Expect = 3.8 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = +3 Query: 159 RYGQDLPVHVSGLPTLRYFYKDRAGHNGNRDEQGDVPASQFDARSAPR 302 +Y D+P +VS LP R Y + G DE+ + D S+P+ Sbjct: 796 QYHVDMPDNVSDLPQTRLCYGACVYNVGLLDEEKRKDLANSDLNSSPK 843 >SPAC3A11.13 ||SPAC3H5.02|prefoldin subunit 6|Schizosaccharomyces pombe|chr 1|||Manual Length = 114 Score = 25.4 bits (53), Expect = 5.1 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 259 ETCLQVNSTQDQLQDIQSVLPDMTDFKYIG-TETMQDADTAK 381 ET LQ N+T L +++ V PD +K IG T Q + AK Sbjct: 26 ETQLQENTTV--LNELEKVAPDSNIYKQIGPTLVKQSHEEAK 65 >SPAP14E8.02 |||transcription factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 566 Score = 25.0 bits (52), Expect = 6.7 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +1 Query: 286 QDQLQDIQSVLPDMTDFKYIGTETMQDADTAKWQMVQPVGDKLNK 420 QD+L+D+ + P + K GT+ D ++W V D L + Sbjct: 479 QDKLRDLAAKHPYFEEVKRYGTDANGDPLWSEWFYNPDVDDDLER 523 >SPBC2D10.20 |ubc1||ubiquitin conjugating enzyme Ubc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 217 Score = 25.0 bits (52), Expect = 6.7 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 Query: 40 QWSPVYTVKGLL 75 QWSPVYT+K L Sbjct: 96 QWSPVYTMKSAL 107 >SPAC31G5.19 |||ATPase with bromodomain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1190 Score = 24.6 bits (51), Expect = 8.9 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +1 Query: 70 LLNIPYAELHEPFYAWYDSKNSKSRIDY 153 L + P +ELH W+ SK S + Y Sbjct: 704 LSSSPLSELHPQLREWFSSKQSVYSLQY 731 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.314 0.132 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,311,155 Number of Sequences: 5004 Number of extensions: 48336 Number of successful extensions: 93 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -