BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31585 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17A2.06c |vps8||WD repeat protein Vps8|Schizosaccharomyces p... 25 6.7 SPBC1105.10 |rav1||RAVE complex subunit Rav1 |Schizosaccharomyce... 25 6.7 >SPAC17A2.06c |vps8||WD repeat protein Vps8|Schizosaccharomyces pombe|chr 1|||Manual Length = 1272 Score = 25.0 bits (52), Expect = 6.7 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -2 Query: 410 KTFQMNEYFWTRCWGLFG*LK 348 + F+ +EY W CW +G L+ Sbjct: 56 RPFRQDEYSWNDCWMRWGQLR 76 >SPBC1105.10 |rav1||RAVE complex subunit Rav1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1297 Score = 25.0 bits (52), Expect = 6.7 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 259 RKFSANLKSFVFSANVLQLTGFLSLDXRWRFHS 161 +++ L +V S + QLT + + W FHS Sbjct: 904 KRYCIMLNQYVLSKHQRQLTSLPTREMAWAFHS 936 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,668,717 Number of Sequences: 5004 Number of extensions: 28210 Number of successful extensions: 66 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -