Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV31585
         (516 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle pr...    50   1e-08
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    21   5.7  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    21   5.7  

>EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle
           protein protein.
          Length = 138

 Score = 50.0 bits (114), Expect = 1e-08
 Identities = 24/56 (42%), Positives = 32/56 (57%)
 Frame = +2

Query: 182 IKAQETGQLKNIGTENEALEVRGEFAYIGPDGVTYAVTYVANEGGFQPSAPHIPKA 349
           I  QE+GQ K +  E   +  +G  +Y  PDG   ++TYVA+E GFQ    HIP A
Sbjct: 52  ISHQESGQPKQVDNETPVVS-QGSDSYTAPDGQQVSITYVADENGFQVQGSHIPTA 106


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.4 bits (43), Expect = 5.7
 Identities = 8/15 (53%), Positives = 12/15 (80%), Gaps = 1/15 (6%)
 Frame = +1

Query: 142  VEGYNTGY-ETSNGN 183
            ++G+N GY ETS+ N
Sbjct: 1039 IQGFNVGYRETSSSN 1053


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.4 bits (43), Expect = 5.7
 Identities = 8/15 (53%), Positives = 12/15 (80%), Gaps = 1/15 (6%)
 Frame = +1

Query: 142  VEGYNTGY-ETSNGN 183
            ++G+N GY ETS+ N
Sbjct: 1035 IQGFNVGYRETSSSN 1049


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 116,247
Number of Sequences: 438
Number of extensions: 2295
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14354847
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)