BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31585 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 50 1e-08 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 5.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 5.7 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 50.0 bits (114), Expect = 1e-08 Identities = 24/56 (42%), Positives = 32/56 (57%) Frame = +2 Query: 182 IKAQETGQLKNIGTENEALEVRGEFAYIGPDGVTYAVTYVANEGGFQPSAPHIPKA 349 I QE+GQ K + E + +G +Y PDG ++TYVA+E GFQ HIP A Sbjct: 52 ISHQESGQPKQVDNETPVVS-QGSDSYTAPDGQQVSITYVADENGFQVQGSHIPTA 106 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/15 (53%), Positives = 12/15 (80%), Gaps = 1/15 (6%) Frame = +1 Query: 142 VEGYNTGY-ETSNGN 183 ++G+N GY ETS+ N Sbjct: 1039 IQGFNVGYRETSSSN 1053 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/15 (53%), Positives = 12/15 (80%), Gaps = 1/15 (6%) Frame = +1 Query: 142 VEGYNTGY-ETSNGN 183 ++G+N GY ETS+ N Sbjct: 1035 IQGFNVGYRETSSSN 1049 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,247 Number of Sequences: 438 Number of extensions: 2295 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -