BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31583 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0181 + 1237167-1237820,1238053-1238142,1238689-1238841,123... 30 1.3 04_04_0852 + 28724891-28725184,28725683-28725801,28726868-28727294 27 8.9 >02_01_0181 + 1237167-1237820,1238053-1238142,1238689-1238841, 1238934-1239045,1239460-1239623,1239709-1240047 Length = 503 Score = 29.9 bits (64), Expect = 1.3 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 3/72 (4%) Frame = -3 Query: 274 FLHCNSIEDEFRLNAAFLTFVYSKK--VYLGHVNEKGNNILVHKDDFLLT-SFKRCSDKV 104 F +S DE A++L +K VYL ++ G+ + +DDF + KR + K Sbjct: 241 FYCSHSYHDELLWAASWLHLASPEKKDVYLSYIGSNGHALGAEQDDFTFSWDDKRVATKG 300 Query: 103 FGQFRVKKLENY 68 F Q R L+ Y Sbjct: 301 FLQSRADGLQLY 312 >04_04_0852 + 28724891-28725184,28725683-28725801,28726868-28727294 Length = 279 Score = 27.1 bits (57), Expect = 8.9 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -3 Query: 187 HVNEKGNNILVHKDDFLLTSFKRCSDKVFGQFRV 86 ++NE GN IL H DF+++S + ++ F ++ Sbjct: 216 YLNEPGNWILYHVGDFVVSSSDQLTNLKFSMMQI 249 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,816,202 Number of Sequences: 37544 Number of extensions: 158500 Number of successful extensions: 264 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 263 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 264 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -