BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31580 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC10F6.09c |psm3|smc3|mitotic cohesin complex subunit Psm3|Sch... 30 0.24 SPAC6G10.02c |tea3||cell end marker Tea3|Schizosaccharomyces pom... 28 0.95 SPBC1105.04c |cbp1|abp1|CENP-B homolog|Schizosaccharomyces pombe... 27 1.3 SPBC20F10.05 |||DuF1740 family protein|Schizosaccharomyces pombe... 27 1.7 SPAPB8E5.07c |||ribosome biogenesis protein Rrp12|Schizosaccharo... 26 2.9 SPCC594.05c |||COMPASS complex subunit |Schizosaccharomyces pomb... 26 3.8 SPAC3A11.14c |pkl1|klp1, SPAC3H5.03c|kinesin-like protein Pkl1|S... 26 3.8 SPAC6G9.06c |pcp1||pericentrin Pcp1|Schizosaccharomyces pombe|ch... 26 3.8 SPBC8D2.13 |||SHQ1 family protein|Schizosaccharomyces pombe|chr ... 25 6.7 SPAC25H1.02 |jmj1||Jmj1 protein|Schizosaccharomyces pombe|chr 1|... 25 8.9 SPBC354.13 |rga6||GTPase activating protein Rga6|Schizosaccharom... 25 8.9 >SPAC10F6.09c |psm3|smc3|mitotic cohesin complex subunit Psm3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1194 Score = 29.9 bits (64), Expect = 0.24 Identities = 14/56 (25%), Positives = 29/56 (51%) Frame = +2 Query: 305 GKPKNIDDANEDTIKRVCKDYHERIARLEDEKFDLEYIVKRKDMEISDLNSQVNDL 472 G ID++ +++KR Y ++ ++ LE ++R + EISD +++ L Sbjct: 837 GSDNRIDESELNSVKRSLLKYENKLQIIKSSSSGLEEQMQRINSEISDKRNELESL 892 >SPAC6G10.02c |tea3||cell end marker Tea3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1125 Score = 27.9 bits (59), Expect = 0.95 Identities = 16/56 (28%), Positives = 31/56 (55%) Frame = +2 Query: 347 KRVCKDYHERIARLEDEKFDLEYIVKRKDMEISDLNSQVNDLRGKFVKPTLKKVSK 514 +R+C+ + + + + +DL++ E S L+ QVNDL + K T +K+S+ Sbjct: 897 QRLCEGRTKELLNSQQKLYDLKHSYSSVMTEKSKLSDQVNDLTEQ-AKITQRKLSE 951 >SPBC1105.04c |cbp1|abp1|CENP-B homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 522 Score = 27.5 bits (58), Expect = 1.3 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 314 KNIDDANEDTIKRVCKDYHERIARLEDEKFDLEYIVKRKD 433 +NI D++ED I ++ Y + A DE+ E+ + KD Sbjct: 435 ENIVDSSEDIINQIASQYMDDRAFETDEEESTEFQITTKD 474 >SPBC20F10.05 |||DuF1740 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 972 Score = 27.1 bits (57), Expect = 1.7 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +2 Query: 365 YHERIARLEDEKFDLEYIVKRKDMEISDLNSQVNDLRGKFVKPTLKK 505 +H+ + +DE Y++ K ME +L+ + + K VK LKK Sbjct: 578 FHQLVFSADDEYLASVYLIYLKQMETKNLSEEKPQV-NKIVKKILKK 623 >SPAPB8E5.07c |||ribosome biogenesis protein Rrp12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1163 Score = 26.2 bits (55), Expect = 2.9 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -1 Query: 183 KPFFAFLALEASSMRLRTSARLRSISACL 97 K FF L E+ +RL+T+ + S+ CL Sbjct: 325 KAFFTLLESESMEIRLQTATTICSVIGCL 353 >SPCC594.05c |||COMPASS complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 424 Score = 25.8 bits (54), Expect = 3.8 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +2 Query: 335 EDTIKRVCKDYHERIARLEDEKFDLEYIVKRKDMEISDLNSQVN 466 ED+ + D+H A E+EK + K ME+ ++N V+ Sbjct: 23 EDSNRGTITDFHIETANNEEEKDANVILNKSVKMEVEEVNGHVD 66 >SPAC3A11.14c |pkl1|klp1, SPAC3H5.03c|kinesin-like protein Pkl1|Schizosaccharomyces pombe|chr 1|||Manual Length = 832 Score = 25.8 bits (54), Expect = 3.8 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -3 Query: 412 FQIEFFIFKTSDAFMVVFANPLNSIFVGVVNVLRFTAPLLD 290 + +++ + K + M V +PL S F+ +N LRF + D Sbjct: 781 YLLKYSLGKGAKTLMFVNVSPLKSQFMDTLNSLRFATKVND 821 >SPAC6G9.06c |pcp1||pericentrin Pcp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1208 Score = 25.8 bits (54), Expect = 3.8 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +2 Query: 365 YHERIARLEDEKFDLEYIVKRKDMEISDLNSQV 463 +HE I +L+D + +L +++K++ IS L V Sbjct: 599 FHESINKLQDREKELTSNLEKKNLVISSLRETV 631 >SPBC8D2.13 |||SHQ1 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 451 Score = 25.0 bits (52), Expect = 6.7 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +2 Query: 383 RLEDEKFDLE-YIVKRKDME-ISDLNSQVNDLRGKFV 487 +LEDEKFD E Y+ D E I ++ + D G+F+ Sbjct: 206 QLEDEKFDAEHYMADFYDREMIDEILHYIPDYIGEFL 242 >SPAC25H1.02 |jmj1||Jmj1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 464 Score = 24.6 bits (51), Expect = 8.9 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +2 Query: 332 NEDTIKRVCKDYHERIARLEDEKFDLEYIVKRKDMEISDLN 454 N++ IK + Y ERI ED+ L+ ++ + E + N Sbjct: 87 NDNDIKNFIRSYAERIVNNEDKNVFLDSLLLSPNYEYLEEN 127 >SPBC354.13 |rga6||GTPase activating protein Rga6|Schizosaccharomyces pombe|chr 2|||Manual Length = 733 Score = 24.6 bits (51), Expect = 8.9 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 364 VFANPLNSIFVGVVNVLRFTAPLLDDAPP 278 VF P+ + N+ +FT P + APP Sbjct: 299 VFGKPIGDLTSDPTNLCKFTFPTPECAPP 327 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,447,807 Number of Sequences: 5004 Number of extensions: 21054 Number of successful extensions: 107 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -