BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31567 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57651| Best HMM Match : Homeobox (HMM E-Value=3e-29) 27 6.9 SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_57651| Best HMM Match : Homeobox (HMM E-Value=3e-29) Length = 294 Score = 27.5 bits (58), Expect = 6.9 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = +2 Query: 155 TNADLFEEDFLQFYQRSYXVNARRVLGAGPKPFNQYTFIPSALDFYQTSARDPAXYQ 325 T AD+F +D FYQ+S + ++ PK SA Y S + P+ YQ Sbjct: 54 TRADMFYQDPFLFYQQSPHYSPHNIVPPSPKYSPHLMGDCSAQSAYFVS-KQPSHYQ 109 >SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 27.1 bits (57), Expect = 9.2 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +2 Query: 221 RRVLGAGPKPFNQ--YTFIPSALDFYQTSARDPAXYQLYKRIVQYIIEFKQYQVPY 382 R VL A KP+ Y F +ALD ++T +D Y + + + EF Q + Y Sbjct: 182 RYVLDALRKPYGSKMYMFGIAALDRFKTRLKDYPHYCQHLASIPHFKEFPQSLIEY 237 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,326,440 Number of Sequences: 59808 Number of extensions: 231704 Number of successful extensions: 533 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 533 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -