BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31566 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29A4.04c |||pseudouridylate synthase |Schizosaccharomyces po... 27 2.2 SPAC4H3.12c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 8.9 >SPAC29A4.04c |||pseudouridylate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 474 Score = 26.6 bits (56), Expect = 2.2 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -1 Query: 507 DRSFTLVNWQRTQWKKYICVLR 442 DR+ LV Q++ K+Y+CVLR Sbjct: 112 DRATRLVKSQQSAGKEYVCVLR 133 >SPAC4H3.12c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 101 Score = 24.6 bits (51), Expect = 8.9 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = -1 Query: 270 CXQYXHSXACMNKLEYIRLKSNAFLYLWXKTSNFKVLISFGKI 142 C Y + A N EYIR + FLY+ S +L S K+ Sbjct: 41 CIFYVYKIALCN--EYIRFLAKCFLYILRCMSTVSLLSSAHKM 81 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,605,575 Number of Sequences: 5004 Number of extensions: 26542 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -