BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31564 (473 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 25 1.8 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 5.4 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 23 5.4 AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsiv... 23 7.2 AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 22 9.5 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 24.6 bits (51), Expect = 1.8 Identities = 16/60 (26%), Positives = 29/60 (48%) Frame = -3 Query: 270 T*RGLPSTSSLPFNSMQALSAASGSSKATKPKPLELPSSLYITL*LVMRPYFSNISFNIS 91 T L + S + +S + G ++ P P +P+S+ I V+ P+ + I FN+S Sbjct: 458 TPENLINLSDISVSSETVVQVLFGLKRSFTPGPDGIPASVLINCKDVLAPHLAKI-FNLS 516 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 5.4 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +2 Query: 206 AAERACI-ELNGKELVEGKPLYVGRAQKKAERQK 304 A +RA + ELN K++++ K Y G+ K +Q+ Sbjct: 1156 ARDRANMPELNMKQILDYKAAYFGKLPKHQHQQQ 1189 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 23.0 bits (47), Expect = 5.4 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 239 KELVEGKPLYVGRAQKKAERQKELKRKFEQLKSE 340 KEL + +P Y +K+ E +EL K EQ + E Sbjct: 342 KELEQVRPRYEAMRRKEEECSRELNLK-EQKRKE 374 >AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsive protein 2 protein. Length = 439 Score = 22.6 bits (46), Expect = 7.2 Identities = 14/54 (25%), Positives = 23/54 (42%) Frame = +2 Query: 86 SDEMLKDMFEKYGRITSHKVMYKDDGNSRGFGFVAFEDPDAAERACIELNGKEL 247 +D L+ + + R S+ D G +V++EDPD A + K L Sbjct: 355 ADAPLRKVGDPTKRFGSYAFRLPDSNGEHGV-WVSYEDPDTAGNKAGYVKAKNL 407 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 22.2 bits (45), Expect = 9.5 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -3 Query: 255 PSTSSLPFNSMQALSAASGSSKATKPKPLELPSSLYIT 142 PS + P M ++ SGS AT P L + Y++ Sbjct: 346 PSMGNDPQTGMGGPASMSGSLSATSPVSPHLQQNGYVS 383 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 400,799 Number of Sequences: 2352 Number of extensions: 7249 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 41670678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -