BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31564 (473 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 26 0.24 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 25 0.55 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.2 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 21 5.1 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 21 6.7 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 21 6.7 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 25.8 bits (54), Expect = 0.24 Identities = 21/75 (28%), Positives = 33/75 (44%) Frame = +2 Query: 8 KXREKELGEKAKLFTNVYVKNFGEDFSDEMLKDMFEKYGRITSHKVMYKDDGNSRGFGFV 187 K R+K +GE +V +GE DE LK F + VM K +G R + + Sbjct: 38 KYRKKCIGETKTTIEDVEATEYGEFPEDEKLKCYFNCV--LEKFNVMDKKNGKIR-YNLL 94 Query: 188 AFEDPDAAERACIEL 232 P+A + +E+ Sbjct: 95 KKVIPEAFKEIGVEM 109 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 24.6 bits (51), Expect = 0.55 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -3 Query: 237 PFNSMQALSAASGSSKATKPKP 172 P +S + LSAA+ SS +T P+P Sbjct: 823 PASSPRYLSAAATSSTSTSPRP 844 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.6 bits (46), Expect = 2.2 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -3 Query: 342 RSDFSCSNLRFNSF*RSAFFCARPT*RGLPSTSSLP 235 R+D S S+ +S + F+ +PT P S LP Sbjct: 368 RTDISSSSSSISSSEENDFWQPKPTLEDAPQNSLLP 403 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 21.4 bits (43), Expect = 5.1 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +2 Query: 212 ERACIELNGKELVEGKPLYVGRAQKKAERQKELKRKFEQ 328 +R I+ K LVE KP K + K+ + KFE+ Sbjct: 83 QREVIKKVIKFLVENKPELWDSLANKYDPDKKFRVKFEE 121 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 21.0 bits (42), Expect = 6.7 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +2 Query: 212 ERACIELNGKELVEGKPLYVGRAQKKAERQKELKRKFEQ 328 +R I+ K LVE KP K + K+ + KFE+ Sbjct: 83 QREVIKKVIKFLVENKPELWDSLANKYDPDKKYRVKFEE 121 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 21.0 bits (42), Expect = 6.7 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +2 Query: 212 ERACIELNGKELVEGKPLYVGRAQKKAERQKELKRKFEQ 328 +R I+ K LVE KP K + K+ + KFE+ Sbjct: 83 QREVIKKVIKFLVENKPELWDSLANKYDPDKKYRVKFEE 121 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,924 Number of Sequences: 438 Number of extensions: 1903 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12805416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -