BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31562 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 1.9 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 1.9 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 22 3.3 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 22 3.3 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 7.5 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 21 10.0 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 10.0 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 21 10.0 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.0 bits (47), Expect = 1.9 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +2 Query: 305 YGVPDIDVFQTVDLWEKKDI--AQVVSTLF 388 Y D D+F LW K +I AQ + +L+ Sbjct: 116 YHAKDFDIFFKTALWAKNNINEAQYIYSLY 145 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.0 bits (47), Expect = 1.9 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +2 Query: 305 YGVPDIDVFQTVDLWEKKDI--AQVVSTLF 388 Y D D+F LW K +I AQ + +L+ Sbjct: 116 YHAKDFDIFFKTALWAKNNINEAQYIYSLY 145 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -1 Query: 177 LRTSSNSSPGGNLAPR 130 LR + SPGGN PR Sbjct: 139 LRHKGDGSPGGNGGPR 154 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -1 Query: 177 LRTSSNSSPGGNLAPR 130 LR + SPGGN PR Sbjct: 139 LRHKGDGSPGGNGGPR 154 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 Query: 95 RRRKPKXWIEGV 130 +RRK W+EGV Sbjct: 992 KRRKEPPWLEGV 1003 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 20.6 bits (41), Expect = 10.0 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = +3 Query: 6 HSXKSTHTITQHVSGTSS 59 ++ K H+I++ +SGTS+ Sbjct: 441 YTYKGAHSISEIMSGTSN 458 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +1 Query: 331 PNRRSMGEKRHRPSSQHTVC 390 P S K+HR SS T C Sbjct: 273 PGHGSPPVKQHRSSSASTTC 292 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 20.6 bits (41), Expect = 10.0 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = +3 Query: 6 HSXKSTHTITQHVSGTSS 59 ++ K H+I++ +SGTS+ Sbjct: 441 YTYKGAHSISEIMSGTSN 458 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,542 Number of Sequences: 438 Number of extensions: 3495 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -