BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31561 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr 2||... 155 3e-39 SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces pomb... 72 6e-14 SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomy... 71 8e-14 SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit Arp42|Sc... 70 2e-13 SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex s... 56 4e-09 SPCC550.12 |arp6||actin-like protein Arp6|Schizosaccharomyces po... 42 5e-05 SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyce... 42 5e-05 SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe... 42 5e-05 SPAC664.02c |||actin-like protein Arp8 |Schizosaccharomyces pomb... 36 0.004 SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit Arp9|Schizosa... 28 0.95 SPAC16.04 |dus3||tRNA dihydrouridine synthase Dus3 |Schizosaccha... 27 1.7 SPBC2D10.03c |||DUF866 domain protein|Schizosaccharomyces pombe|... 25 5.1 SPBC30D10.06 |lsm4||U6 snRNP-associated protein Lsm4|Schizosacch... 25 5.1 SPCC1682.02c |mcm3||MCM complex subunit Mcm3|Schizosaccharomyces... 25 6.7 SPCC162.02c |||AMP-binding dehydrogenase |Schizosaccharomyces po... 25 6.7 SPBP4H10.11c |||long-chain-fatty-acid-CoA ligase |Schizosaccharo... 25 8.9 >SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr 2|||Manual Length = 375 Score = 155 bits (377), Expect = 3e-39 Identities = 70/77 (90%), Positives = 76/77 (98%) Frame = -1 Query: 516 VMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 337 VMSGGTTMYPGIADRMQKEI ALAPS++K+KI+APPERKYSVWIGGSILASLSTFQQMWI Sbjct: 298 VMSGGTTMYPGIADRMQKEIQALAPSSMKVKIVAPPERKYSVWIGGSILASLSTFQQMWI 357 Query: 336 SKEEYDESGPGIVHRKC 286 SK+EYDESGPGIV+RKC Sbjct: 358 SKQEYDESGPGIVYRKC 374 >SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 379 Score = 71.7 bits (168), Expect = 6e-14 Identities = 33/76 (43%), Positives = 50/76 (65%) Frame = -1 Query: 516 VMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 337 V+SGG+T+ G +R E+ A++ ++KI A PER ++ W+GGSILASLSTF+++ I Sbjct: 303 VLSGGSTLLRGFGERFISELRAISGKKNQVKIYASPERMHNAWLGGSILASLSTFRRLLI 362 Query: 336 SKEEYDESGPGIVHRK 289 + EEY I R+ Sbjct: 363 TSEEYKNDQNVIFRRR 378 >SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomyces pombe|chr 2|||Manual Length = 433 Score = 71.3 bits (167), Expect = 8e-14 Identities = 34/83 (40%), Positives = 56/83 (67%), Gaps = 6/83 (7%) Frame = -1 Query: 516 VMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPP---ERKYSVWIGGSILASLSTFQQ 346 ++ GGT++ G + R+Q E++ L P + ++KI A ER Y+ W+GGSIL+SL TF Q Sbjct: 351 IVCGGTSLMQGFSLRLQNELSKLYPGS-RLKIHASGHVVERSYASWLGGSILSSLGTFHQ 409 Query: 345 MWISKEEYDESGP---GIVHRKC 286 +WIS++EY+E G ++ ++C Sbjct: 410 LWISRQEYEEHGSDRLALIEKRC 432 >SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit Arp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 430 Score = 69.7 bits (163), Expect = 2e-13 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 2/71 (2%) Frame = -1 Query: 516 VMSGGTTMYPGIADRMQKEITALAP-STIKIKIIAPPER-KYSVWIGGSILASLSTFQQM 343 V++GGT++ PG+++R+Q E+ LA S I + +VW GGSILASL FQ + Sbjct: 348 VVTGGTSLIPGLSERLQAEVQRLATGSRINVHTAETASATSNAVWFGGSILASLDNFQHL 407 Query: 342 WISKEEYDESG 310 W+SK+EYDE G Sbjct: 408 WVSKQEYDEVG 418 >SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex subunit Arp2|Schizosaccharomyces pombe|chr 1|||Manual Length = 390 Score = 55.6 bits (128), Expect = 4e-09 Identities = 31/81 (38%), Positives = 51/81 (62%), Gaps = 12/81 (14%) Frame = -1 Query: 516 VMSGGTTMYPGIADRMQKEITAL--------APSTI---KIKIIAPPERKYSVWIGGSIL 370 V+SGG++MY G+ R++KEI L P+ + K+KI P R+++V+IGG++L Sbjct: 298 VLSGGSSMYAGLPSRLEKEIKQLWFERVLHGDPARLPNFKVKIEDAPRRRHAVFIGGAVL 357 Query: 369 AS-LSTFQQMWISKEEYDESG 310 A ++ MW+SK E++E G Sbjct: 358 ADIMAQNDHMWVSKAEWEEYG 378 >SPCC550.12 |arp6||actin-like protein Arp6|Schizosaccharomyces pombe|chr 3|||Manual Length = 401 Score = 41.9 bits (94), Expect = 5e-05 Identities = 23/76 (30%), Positives = 37/76 (48%) Frame = -1 Query: 516 VMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 337 V GG +PG R+ E+ +LAP+ ++K+ P + W S + L + I Sbjct: 324 VTIGGNCKFPGFHKRLSSELRSLAPANWEVKVFEPSDPICFPWKKASHM-PLEHWNANKI 382 Query: 336 SKEEYDESGPGIVHRK 289 ++ EY E G I+ RK Sbjct: 383 TRSEYSEHGANIMTRK 398 >SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyces pombe|chr 1|||Manual Length = 427 Score = 41.9 bits (94), Expect = 5e-05 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 14/89 (15%) Frame = -1 Query: 516 VMSGGTTMYPGIADRMQKEITALAPSTIK--------------IKIIAPPERKYSVWIGG 379 V+SGG+T++ +R+Q+++ + I + +I+ ++ +VW GG Sbjct: 331 VLSGGSTLFKNFGNRLQRDLKRIVDERIHRSEMLSGAKSGGVDVNVISHKRQRNAVWFGG 390 Query: 378 SILASLSTFQQMWISKEEYDESGPGIVHR 292 S+LA F +K +Y+E G I R Sbjct: 391 SLLAQTPEFGSYCHTKADYEEYGASIARR 419 >SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe|chr 2|||Manual Length = 721 Score = 41.9 bits (94), Expect = 5e-05 Identities = 19/70 (27%), Positives = 35/70 (50%) Frame = -1 Query: 516 VMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 337 +++GG PG+ R+++E+T++ P I + W G S + F+ + Sbjct: 639 LITGGLGSLPGMETRIKRELTSIMPVGSSINVFRASNPLLDAWKGASEWSVTEKFKAAKV 698 Query: 336 SKEEYDESGP 307 ++EEY E GP Sbjct: 699 TREEYLEKGP 708 >SPAC664.02c |||actin-like protein Arp8 |Schizosaccharomyces pombe|chr 1|||Manual Length = 620 Score = 35.9 bits (79), Expect = 0.004 Identities = 17/76 (22%), Positives = 34/76 (44%), Gaps = 3/76 (3%) Frame = -1 Query: 507 GGTTMYPGIADRMQKEITALAPSTIKIKIIAPP---ERKYSVWIGGSILASLSTFQQMWI 337 GG +PG A +++ I + + I +I PP + ++ W G I + ++WI Sbjct: 537 GGAGQFPGFAHLLEERIHSKRANIPTISVIPPPRSMDAQFVAWKGACIYNRIRIVSELWI 596 Query: 336 SKEEYDESGPGIVHRK 289 ++ G ++ K Sbjct: 597 KNSDWKMLGSRVLQYK 612 >SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit Arp9|Schizosaccharomyces pombe|chr 1|||Manual Length = 523 Score = 27.9 bits (59), Expect = 0.95 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 3/37 (8%) Frame = -1 Query: 390 WIGGSILASLSTFQQM---WISKEEYDESGPGIVHRK 289 ++GGSI+A S + + +++ EEY + GP +H K Sbjct: 486 FLGGSIVAKTSFNESVSSHYVTLEEYAQHGPTAIHTK 522 >SPAC16.04 |dus3||tRNA dihydrouridine synthase Dus3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 617 Score = 27.1 bits (57), Expect = 1.7 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 465 KEITALAPSTIKIKIIAPPERKYSVWIGGSILASLST 355 KEI++ A S I + + P E+ W ILA L+T Sbjct: 212 KEISSQARSNIALPTLRPQEKNLIDWRDRKILAPLTT 248 >SPBC2D10.03c |||DUF866 domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 157 Score = 25.4 bits (53), Expect = 5.1 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 227 ELGRAQHHTAPGSRGRAAXKHLRWT 301 E+ R++ H+ PGS+G A +L WT Sbjct: 46 EISRSETHSIPGSKGEA---NLIWT 67 >SPBC30D10.06 |lsm4||U6 snRNP-associated protein Lsm4|Schizosaccharomyces pombe|chr 2|||Manual Length = 121 Score = 25.4 bits (53), Expect = 5.1 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +2 Query: 215 RLRSELGRAQH-HTAPGSRGRAAXKHL 292 R R + GR + HTAP RGR H+ Sbjct: 95 RGRGQRGRGNYGHTAPNRRGRGRGGHM 121 >SPCC1682.02c |mcm3||MCM complex subunit Mcm3|Schizosaccharomyces pombe|chr 3|||Manual Length = 879 Score = 25.0 bits (52), Expect = 6.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 Query: 439 DHQDQDHRSPREEVLRMDRWIHPG 368 D D+ R+ E VLRM R++ PG Sbjct: 499 DIDDKKDRALSEHVLRMHRYLPPG 522 >SPCC162.02c |||AMP-binding dehydrogenase |Schizosaccharomyces pombe|chr 3|||Manual Length = 981 Score = 25.0 bits (52), Expect = 6.7 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 2/58 (3%) Frame = -2 Query: 236 VRVLNATVSTLYLVIP--EN*TSNLTPSILM*FIVKFYINLISFLFLLYTRDRCGSQR 69 VR +A S +L P N SN TP+ + I K N+ S + L D C R Sbjct: 575 VRFFHAIQSHFHLEGPIRYNMNSNCTPNSIASIIQKKSYNVSSITYELLNEDACALSR 632 >SPBP4H10.11c |||long-chain-fatty-acid-CoA ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 689 Score = 24.6 bits (51), Expect = 8.9 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 398 YFLSGGAMILILMVEGARAVISFCILSAIPGY 493 Y +SGGA + +A +S CI +PGY Sbjct: 412 YCISGGAAL----AASTQAFLSSCICPVLPGY 439 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,681,862 Number of Sequences: 5004 Number of extensions: 28516 Number of successful extensions: 78 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -