BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31559 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF125969-2|AAD14761.1| 613|Caenorhabditis elegans Caenorhabditi... 27 6.0 Z70270-3|CAA94227.1| 153|Caenorhabditis elegans Hypothetical pr... 27 8.0 >AF125969-2|AAD14761.1| 613|Caenorhabditis elegans Caenorhabditis gtp-binding proteinprotein 1 protein. Length = 613 Score = 27.5 bits (58), Expect = 6.0 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -1 Query: 447 EKVWQERAEQFGGRQKARLPKWFGERP--GKKKGELE 343 E + Q+RA+Q GRQK K G +P GK K ++E Sbjct: 555 ESLAQQRAKQKDGRQKQYGKKSMGPKPPNGKPKEKIE 591 >Z70270-3|CAA94227.1| 153|Caenorhabditis elegans Hypothetical protein C53D6.5 protein. Length = 153 Score = 27.1 bits (57), Expect = 8.0 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 516 TRSYDDKKKLFEGDLEKLNKDFLEKVWQER 427 T + ++KL + L+K D L+K WQER Sbjct: 88 TEKLEIEQKLKDPKLDKATSDELKKQWQER 117 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,705,136 Number of Sequences: 27780 Number of extensions: 91285 Number of successful extensions: 362 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 362 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -