BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31555 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2F7.10 |||palmitoyltransferase |Schizosaccharomyces pombe|ch... 25 6.7 SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 25 6.7 >SPAC2F7.10 |||palmitoyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 642 Score = 25.0 bits (52), Expect = 6.7 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -3 Query: 184 MDFCFLIIKKNLCFXDCF 131 +D C L+I+++ CF CF Sbjct: 571 LDQCILLIRESNCFVRCF 588 >SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 188 Score = 25.0 bits (52), Expect = 6.7 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -2 Query: 287 SIYENKNVKFK*IQLICYKLVYILFSIKLCFLHSHGFLFSNHQEESLFSRL 135 S++ + F + +C +L+S LH+ FLFS+ S F RL Sbjct: 9 SLFSSFESLFFRLFFVCSFFFPLLYSFIFATLHAFVFLFSHTLVSSQFRRL 59 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,448,360 Number of Sequences: 5004 Number of extensions: 21188 Number of successful extensions: 34 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -