Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV31555
         (516 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U42844-8|AAB53820.1|  400|Caenorhabditis elegans Hypothetical pr...    33   0.12 

>U42844-8|AAB53820.1|  400|Caenorhabditis elegans Hypothetical
           protein C08A9.8 protein.
          Length = 400

 Score = 33.1 bits (72), Expect = 0.12
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 3/57 (5%)
 Frame = -2

Query: 308 GSQCKRKSIYENKNVKFK*IQLICYKLVYILFSIKLC---FLHSHGFLFSNHQEESL 147
           G+ CK    Y NK +K K ++L  Y   Y +FS K     FL+ H F F  H+ ESL
Sbjct: 86  GNNCKHFIQYPNKQIKTKLLKLKSYSNKYKMFSRKKIYRKFLNIHCFKF--HKFESL 140


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,825,348
Number of Sequences: 27780
Number of extensions: 115098
Number of successful extensions: 202
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 200
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 201
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 996506972
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)