BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31548 (415 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X16869-1|CAA34756.1| 462|Homo sapiens protein ( Human mRNA for ... 34 0.16 X03558-1|CAA27245.1| 462|Homo sapiens protein ( Human mRNA for ... 34 0.16 M29548-1|AAA52367.1| 327|Homo sapiens EEF1A protein. 34 0.16 M27364-1|AAA52344.1| 227|Homo sapiens EEF1A protein. 34 0.16 L41498-1|AAC09386.1| 398|Homo sapiens longation factor 1-alpha ... 34 0.16 L41490-1|AAC09385.1| 398|Homo sapiens eukaryotic translation el... 34 0.16 J04617-1|AAA52343.1| 462|Homo sapiens EEF1A protein. 34 0.16 EF362804-1|ABO30531.1| 462|Homo sapiens EF1a protein. 34 0.16 DQ185041-1|ABD14421.1| 93|Homo sapiens eukaryotic translation ... 34 0.16 BC111051-1|AAI11052.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 BC094687-1|AAH94687.1| 308|Homo sapiens EEF1A1 protein protein. 34 0.16 BC082268-1|AAH82268.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 BC072385-1|AAH72385.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 BC071841-1|AAH71841.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 BC071741-1|AAH71741.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 BC071727-1|AAH71727.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 BC071619-1|AAH71619.1| 441|Homo sapiens EEF1A1 protein protein. 34 0.16 BC066893-1|AAH66893.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 BC065761-1|AAH65761.1| 251|Homo sapiens EEF1A1 protein protein. 34 0.16 BC063511-1|AAH63511.1| 290|Homo sapiens EEF1A1 protein protein. 34 0.16 BC057391-1|AAH57391.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 BC038339-1|AAH38339.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 BC028674-1|AAH28674.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 BC022412-1|AAH22412.1| 250|Homo sapiens Unknown (protein for IM... 34 0.16 BC021686-1|AAH21686.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 BC019669-1|AAH19669.1| 462|Homo sapiens EEF1A1 protein protein. 34 0.16 BC018641-1|AAH18641.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 BC018150-1|AAH18150.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 BC014892-1|AAH14892.1| 248|Homo sapiens Unknown (protein for IM... 34 0.16 BC014377-1|AAH14377.1| 287|Homo sapiens Unknown (protein for IM... 34 0.16 BC014224-1|AAH14224.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 BC012891-1|AAH12891.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 BC012509-1|AAH12509.1| 161|Homo sapiens EEF1A1 protein protein. 34 0.16 BC010735-1|AAH10735.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 BC009875-1|AAH09875.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 BC009733-1|AAH09733.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 BC008587-1|AAH08587.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 AY062434-1|AAL38981.1| 398|Homo sapiens elongation factor 1-alp... 34 0.16 AY043301-1|AAK95378.1| 462|Homo sapiens elongation factor 1-alp... 34 0.16 AL603910-8|CAI14883.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 AL593851-4|CAH73620.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 AK223046-1|BAD96766.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 AK223042-1|BAD96762.1| 433|Homo sapiens eukaryotic translation ... 34 0.16 AK223030-1|BAD96750.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 AK222982-1|BAD96702.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 AK222551-1|BAD96271.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 AK222523-1|BAD96243.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 AK222519-1|BAD96239.1| 366|Homo sapiens eukaryotic translation ... 34 0.16 AK222515-1|BAD96235.1| 462|Homo sapiens eukaryotic translation ... 34 0.16 AF397403-1|AAK93966.1| 398|Homo sapiens translation elongation ... 34 0.16 AF328730-1|AAN09722.1| 361|Homo sapiens CTCL tumor antigen HD-C... 34 0.16 AF322220-1|AAN51932.1| 361|Homo sapiens cervical cancer suppres... 34 0.16 AF174496-1|AAF36537.1| 426|Homo sapiens glucocorticoid receptor... 34 0.16 X70940-1|CAA50280.1| 463|Homo sapiens elongation factor 1 alpha... 31 1.1 BC110409-1|AAI10410.1| 463|Homo sapiens eukaryotic translation ... 31 1.1 BC000432-1|AAH00432.1| 463|Homo sapiens eukaryotic translation ... 31 1.1 AL121829-9|CAC15522.1| 463|Homo sapiens EEF1A2 protein. 31 1.1 AF163763-1|AAF80488.1| 463|Homo sapiens elongation factor 1 A-2... 31 1.1 DQ096628-1|AAZ74794.1| 1835|Homo sapiens zipzap protein protein. 29 6.1 AY727870-1|AAU20329.2| 1113|Homo sapiens ARID2 protein. 29 6.1 AL832200-1|CAD91164.1| 1686|Homo sapiens hypothetical protein pr... 29 6.1 L10340-1|AAA91835.1| 435|Homo sapiens elongation factor-1 alpha... 29 8.1 >X16869-1|CAA34756.1| 462|Homo sapiens protein ( Human mRNA for elongation factor 1-alpha (clone CEF4). ). Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >X03558-1|CAA27245.1| 462|Homo sapiens protein ( Human mRNA for elongation factor 1 alpha subunit (EF-1 alpha). ). Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >M29548-1|AAA52367.1| 327|Homo sapiens EEF1A protein. Length = 327 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 291 VRDMRQTVAVGVIKAVD 307 >M27364-1|AAA52344.1| 227|Homo sapiens EEF1A protein. Length = 227 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 191 VRDMRQTVAVGVIKAVD 207 >L41498-1|AAC09386.1| 398|Homo sapiens longation factor 1-alpha 1 protein. Length = 398 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 362 VRDMRQTVAVGVIKAVD 378 >L41490-1|AAC09385.1| 398|Homo sapiens eukaryotic translation elongation factor 1 alpha 1-like 14 protein. Length = 398 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 362 VRDMRQTVAVGVIKAVD 378 >J04617-1|AAA52343.1| 462|Homo sapiens EEF1A protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >EF362804-1|ABO30531.1| 462|Homo sapiens EF1a protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >DQ185041-1|ABD14421.1| 93|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 93 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 57 VRDMRQTVAVGVIKAVD 73 >BC111051-1|AAI11052.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >BC094687-1|AAH94687.1| 308|Homo sapiens EEF1A1 protein protein. Length = 308 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 272 VRDMRQTVAVGVIKAVD 288 >BC082268-1|AAH82268.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >BC072385-1|AAH72385.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >BC071841-1|AAH71841.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >BC071741-1|AAH71741.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >BC071727-1|AAH71727.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >BC071619-1|AAH71619.1| 441|Homo sapiens EEF1A1 protein protein. Length = 441 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 405 VRDMRQTVAVGVIKAVD 421 >BC066893-1|AAH66893.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >BC065761-1|AAH65761.1| 251|Homo sapiens EEF1A1 protein protein. Length = 251 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 215 VRDMRQTVAVGVIKAVD 231 >BC063511-1|AAH63511.1| 290|Homo sapiens EEF1A1 protein protein. Length = 290 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 254 VRDMRQTVAVGVIKAVD 270 >BC057391-1|AAH57391.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >BC038339-1|AAH38339.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >BC028674-1|AAH28674.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >BC022412-1|AAH22412.1| 250|Homo sapiens Unknown (protein for IMAGE:4134193) protein. Length = 250 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 214 VRDMRQTVAVGVIKAVD 230 >BC021686-1|AAH21686.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >BC019669-1|AAH19669.1| 462|Homo sapiens EEF1A1 protein protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >BC018641-1|AAH18641.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >BC018150-1|AAH18150.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >BC014892-1|AAH14892.1| 248|Homo sapiens Unknown (protein for IMAGE:3909122) protein. Length = 248 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 212 VRDMRQTVAVGVIKAVD 228 >BC014377-1|AAH14377.1| 287|Homo sapiens Unknown (protein for IMAGE:4041545) protein. Length = 287 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 251 VRDMRQTVAVGVIKAVD 267 >BC014224-1|AAH14224.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >BC012891-1|AAH12891.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >BC012509-1|AAH12509.1| 161|Homo sapiens EEF1A1 protein protein. Length = 161 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 125 VRDMRQTVAVGVIKAVD 141 >BC010735-1|AAH10735.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >BC009875-1|AAH09875.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >BC009733-1|AAH09733.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >BC008587-1|AAH08587.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >AY062434-1|AAL38981.1| 398|Homo sapiens elongation factor 1-alpha 1 protein. Length = 398 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 362 VRDMRQTVAVGVIKAVD 378 >AY043301-1|AAK95378.1| 462|Homo sapiens elongation factor 1-alpha protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >AL603910-8|CAI14883.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >AL593851-4|CAH73620.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha-like 3 protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >AK223046-1|BAD96766.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 variant protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >AK223042-1|BAD96762.1| 433|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 variant protein. Length = 433 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 397 VRDMRQTVAVGVIKAVD 413 >AK223030-1|BAD96750.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 variant protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >AK222982-1|BAD96702.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 variant protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >AK222551-1|BAD96271.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 variant protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >AK222523-1|BAD96243.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 variant protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >AK222519-1|BAD96239.1| 366|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 variant protein. Length = 366 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 330 VRDMRQTVAVGVIKAVD 346 >AK222515-1|BAD96235.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 variant protein. Length = 462 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 426 VRDMRQTVAVGVIKAVD 442 >AF397403-1|AAK93966.1| 398|Homo sapiens translation elongation factor 1 alpha 1-like 14 protein. Length = 398 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 362 VRDMRQTVAVGVIKAVD 378 >AF328730-1|AAN09722.1| 361|Homo sapiens CTCL tumor antigen HD-CL-08 protein. Length = 361 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 325 VRDMRQTVAVGVIKAVD 341 >AF322220-1|AAN51932.1| 361|Homo sapiens cervical cancer suppressor 3 protein. Length = 361 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 325 VRDMRQTVAVGVIKAVD 341 >AF174496-1|AAF36537.1| 426|Homo sapiens glucocorticoid receptor AF-1 specific elongation factor protein. Length = 426 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIKAV+ Sbjct: 390 VRDMRQTVAVGVIKAVD 406 >X70940-1|CAA50280.1| 463|Homo sapiens elongation factor 1 alpha-2 protein. Length = 463 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAV 49 VRDMRQTVAVGVIK V Sbjct: 426 VRDMRQTVAVGVIKNV 441 >BC110409-1|AAI10410.1| 463|Homo sapiens eukaryotic translation elongation factor 1 alpha 2 protein. Length = 463 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAV 49 VRDMRQTVAVGVIK V Sbjct: 426 VRDMRQTVAVGVIKNV 441 >BC000432-1|AAH00432.1| 463|Homo sapiens eukaryotic translation elongation factor 1 alpha 2 protein. Length = 463 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAV 49 VRDMRQTVAVGVIK V Sbjct: 426 VRDMRQTVAVGVIKNV 441 >AL121829-9|CAC15522.1| 463|Homo sapiens EEF1A2 protein. Length = 463 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAV 49 VRDMRQTVAVGVIK V Sbjct: 426 VRDMRQTVAVGVIKNV 441 >AF163763-1|AAF80488.1| 463|Homo sapiens elongation factor 1 A-2 protein. Length = 463 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAV 49 VRDMRQTVAVGVIK V Sbjct: 426 VRDMRQTVAVGVIKNV 441 >DQ096628-1|AAZ74794.1| 1835|Homo sapiens zipzap protein protein. Length = 1835 Score = 29.1 bits (62), Expect = 6.1 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 6/57 (10%) Frame = -2 Query: 156 RSCMKNCAVNSSSYFLPLVAF------SAALVTLPPPASLKLTALMTPTATVCLMSR 4 R+C++ +++ S+F+ L + A L P K T LM T T CLMSR Sbjct: 310 RTCLRFLLLSAHSHFISLRQLGLDTLGNIAAELLLDPVDFKTTHLMFHTVTKCLMSR 366 >AY727870-1|AAU20329.2| 1113|Homo sapiens ARID2 protein. Length = 1113 Score = 29.1 bits (62), Expect = 6.1 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 6/57 (10%) Frame = -2 Query: 156 RSCMKNCAVNSSSYFLPLVAF------SAALVTLPPPASLKLTALMTPTATVCLMSR 4 R+C++ +++ S+F+ L + A L P K T LM T T CLMSR Sbjct: 310 RTCLRFLLLSAHSHFISLRQLGLDTLGNIAAELLLDPVDFKTTHLMFHTVTKCLMSR 366 >AL832200-1|CAD91164.1| 1686|Homo sapiens hypothetical protein protein. Length = 1686 Score = 29.1 bits (62), Expect = 6.1 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 6/57 (10%) Frame = -2 Query: 156 RSCMKNCAVNSSSYFLPLVAF------SAALVTLPPPASLKLTALMTPTATVCLMSR 4 R+C++ +++ S+F+ L + A L P K T LM T T CLMSR Sbjct: 161 RTCLRFLLLSAHSHFISLRQLGLDTLGNIAAELLLDPVDFKTTHLMFHTVTKCLMSR 217 >L10340-1|AAA91835.1| 435|Homo sapiens elongation factor-1 alpha protein. Length = 435 Score = 28.7 bits (61), Expect = 8.1 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAV 49 V DMRQTVAVGVIK V Sbjct: 398 VPDMRQTVAVGVIKNV 413 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 48,681,544 Number of Sequences: 237096 Number of extensions: 820519 Number of successful extensions: 1491 Number of sequences better than 10.0: 62 Number of HSP's better than 10.0 without gapping: 1483 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1491 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3087725076 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -