BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31548 (415 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60390.1 68418.m07574 elongation factor 1-alpha / EF-1-alpha ... 33 0.076 At1g07940.1 68414.m00863 elongation factor 1-alpha / EF-1-alpha ... 33 0.076 At1g07930.1 68414.m00862 elongation factor 1-alpha / EF-1-alpha ... 33 0.076 At1g07920.1 68414.m00861 elongation factor 1-alpha / EF-1-alpha ... 33 0.076 At1g35550.1 68414.m04414 elongation factor Tu C-terminal domain-... 31 0.41 At1g55420.1 68414.m06339 DC1 domain-containing protein contains ... 29 1.6 At2g04740.1 68415.m00484 ankyrin repeat family protein contains ... 28 2.9 At1g55380.1 68414.m06334 DC1 domain-containing protein contains ... 28 2.9 At2g04500.1 68415.m00455 DC1 domain-containing protein contains ... 27 5.0 At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa... 27 6.6 At1g71970.1 68414.m08319 expressed protein 26 8.7 >At5g60390.1 68418.m07574 elongation factor 1-alpha / EF-1-alpha identical to SWISS-PROT:P13905 elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana] Length = 449 Score = 33.1 bits (72), Expect = 0.076 Identities = 15/17 (88%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIK+V+ Sbjct: 414 VRDMRQTVAVGVIKSVD 430 >At1g07940.1 68414.m00863 elongation factor 1-alpha / EF-1-alpha identical to GB:CAA34456 from [Arabidopsis thaliana] (Plant Mol. Biol. 14 (1), 107-110 (1990)) Length = 449 Score = 33.1 bits (72), Expect = 0.076 Identities = 15/17 (88%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIK+V+ Sbjct: 414 VRDMRQTVAVGVIKSVD 430 >At1g07930.1 68414.m00862 elongation factor 1-alpha / EF-1-alpha identical to GB:CAA34456 from [Arabidopsis thaliana] (Plant Mol. Biol. 14 (1), 107-110 (1990)) Length = 449 Score = 33.1 bits (72), Expect = 0.076 Identities = 15/17 (88%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIK+V+ Sbjct: 414 VRDMRQTVAVGVIKSVD 430 >At1g07920.1 68414.m00861 elongation factor 1-alpha / EF-1-alpha identical to GB:CAA34456 from [Arabidopsis thaliana] (Plant Mol. Biol. 14 (1), 107-110 (1990)) Length = 449 Score = 33.1 bits (72), Expect = 0.076 Identities = 15/17 (88%), Positives = 17/17 (100%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAVN 52 VRDMRQTVAVGVIK+V+ Sbjct: 414 VRDMRQTVAVGVIKSVD 430 >At1g35550.1 68414.m04414 elongation factor Tu C-terminal domain-containing protein similar to SP|P13905 Elongation factor 1-alpha (EF-1-alpha) {Arabidopsis thaliana}; contains Pfam profile PF03143: Elongation factor Tu C-terminal domain Length = 104 Score = 30.7 bits (66), Expect = 0.41 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +2 Query: 2 VRDMRQTVAVGVIKAV 49 +RDMRQTV VGVIK+V Sbjct: 80 IRDMRQTVGVGVIKSV 95 >At1g55420.1 68414.m06339 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 725 Score = 28.7 bits (61), Expect = 1.6 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 5/38 (13%) Frame = +1 Query: 220 IFYKACN---VTLFYNLYKVIHNI--SETFCYDCKLKC 318 I+ K C+ V LFY ++ N S FCY C+L+C Sbjct: 619 IYLKPCHIFKVGLFYKEVEIARNDGNSRLFCYICRLRC 656 >At2g04740.1 68415.m00484 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 578 Score = 27.9 bits (59), Expect = 2.9 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Frame = -2 Query: 204 VCSPFFLRNTFR*MKYRS-CMKNCAVNSSSYFLPLVAFSAALVTLPPPASLKLTALMTPT 28 +C L + + +K R C+ A N + F+ F A L+TLPPP+ P+ Sbjct: 453 LCQWLVLSDMYGVLKIREYCLDLVACNFEA-FVETHEFRAMLLTLPPPSGDSSLRTTVPS 511 Query: 27 ATVCLMS 7 A +M+ Sbjct: 512 APGAMMT 518 >At1g55380.1 68414.m06334 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 661 Score = 27.9 bits (59), Expect = 2.9 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 5/38 (13%) Frame = +1 Query: 220 IFYKACN---VTLFYNLYKVIHNI--SETFCYDCKLKC 318 I+ K C+ V L+Y ++ N S FCY C+L+C Sbjct: 579 IYLKPCHIFKVGLYYKEVEIARNDGNSRLFCYTCELRC 616 >At2g04500.1 68415.m00455 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 495 Score = 27.1 bits (57), Expect = 5.0 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +1 Query: 274 HNISETFCYDCKLKCKF 324 + ++ FC+ C+L+CKF Sbjct: 444 NGVTRPFCFHCELRCKF 460 >At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam profiles PF00085: Thioredoxin, PF00515: TPR Domain; similar to tetratricopeptide repeat protein 2 (GI:7248701) [Drosophila melanogaster]; similar to DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615) [Homo sapiens] Length = 699 Score = 26.6 bits (56), Expect = 6.6 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = -2 Query: 141 NCAVNSSSYFLPLVAFSAALVTLPPPASLKLTALMTPTATVC 16 + +SSS+ PL++ S++ T P P S A + PT +C Sbjct: 106 SATTSSSSHSQPLLSSSSSSATSPAPTS---PANVLPTGNIC 144 >At1g71970.1 68414.m08319 expressed protein Length = 225 Score = 26.2 bits (55), Expect = 8.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -2 Query: 159 YRSCMKNCAVNSSSYFLPLVAFSAALVTLPP 67 Y SC + CAV S +LP +A+ L P Sbjct: 191 YGSCRRTCAVTESIVYLPRARKAASYDNLLP 221 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,029,363 Number of Sequences: 28952 Number of extensions: 114966 Number of successful extensions: 262 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 257 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 262 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 625471056 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -