BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31547 (502 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC306.11 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||... 27 1.6 SPBC577.06c |||phosphatidylinositol kinase |Schizosaccharomyces ... 25 6.4 SPAC1565.01 |||conserved fungal protein|Schizosaccharomyces pomb... 25 8.4 SPBC887.19 |rft1||human RFT1 ortholog |Schizosaccharomyces pombe... 25 8.4 SPCC1223.04c |mug76||lysine methyltransferase |Schizosaccharomyc... 25 8.4 >SPCC306.11 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 283 Score = 27.1 bits (57), Expect = 1.6 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 26 PYCMDSCMNSDHYCPNCNAYIGT 94 PY +++C N Y NCN+ + T Sbjct: 203 PYLVNTCFNGTQYPVNCNSALRT 225 >SPBC577.06c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1877 Score = 25.0 bits (52), Expect = 6.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 285 FIXSLSKSSRQVLSVDDYFQKIL 353 F+ SLSK R S D FQK+L Sbjct: 770 FVESLSKERRVASSTIDEFQKLL 792 >SPAC1565.01 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 242 Score = 24.6 bits (51), Expect = 8.4 Identities = 11/30 (36%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = -1 Query: 130 RNTFT-IMKLSCIGSNVGVAVWTVMVRIHA 44 RNT++ + K + +GS++G+A W + R A Sbjct: 14 RNTYSALFKGALVGSSLGIAGWLIGNRYSA 43 >SPBC887.19 |rft1||human RFT1 ortholog |Schizosaccharomyces pombe|chr 2|||Manual Length = 527 Score = 24.6 bits (51), Expect = 8.4 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 Query: 231 LWSIFCSFILKHWR 272 L SI SF++KHWR Sbjct: 469 LLSIISSFLVKHWR 482 >SPCC1223.04c |mug76||lysine methyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 381 Score = 24.6 bits (51), Expect = 8.4 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 285 FIXSLSKSSRQVLSVDDYFQKILQGYL 365 +I S SR V+DY +K+LQ L Sbjct: 312 YINGFSDGSRDRQDVEDYLKKVLQELL 338 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,843,007 Number of Sequences: 5004 Number of extensions: 35327 Number of successful extensions: 83 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 198176188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -