BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31542 (405 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like prote... 21 3.5 AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 21 4.6 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 21 6.1 >AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like protein protein. Length = 160 Score = 21.4 bits (43), Expect = 3.5 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +2 Query: 128 PWRSPESAQLKPHTGNH 178 PW + Q+K +GNH Sbjct: 141 PWFAEHMGQIKVASGNH 157 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 21.0 bits (42), Expect = 4.6 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -2 Query: 395 TVVKLLT*CKKRVCELSAKHETVFVLVIQLQTFQEIF 285 T K L K+ V L +F+L + TF +IF Sbjct: 80 TKAKNLLYSKQIVTILKKTKSNIFILKESVDTFNDIF 116 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 20.6 bits (41), Expect = 6.1 Identities = 12/51 (23%), Positives = 25/51 (49%) Frame = -2 Query: 404 SXFTVVKLLT*CKKRVCELSAKHETVFVLVIQLQTFQEIFIRSLVFVVLCL 252 S +TV+ + +++ C+L +K LV TF +L ++++ L Sbjct: 77 SCYTVLAPVLCKRQQYCQLMSKLLGNHQLVYNCHTFGRFLAPNLTYLLVAL 127 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,593 Number of Sequences: 336 Number of extensions: 1283 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8752267 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -