BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31536 (370 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS... 167 1e-43 AY825878-1|AAV70441.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825877-1|AAV70440.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825876-1|AAV70439.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825875-1|AAV70438.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825874-1|AAV70437.1| 162|Anopheles gambiae voltage gated sodi... 24 1.6 AY825873-1|AAV70436.1| 162|Anopheles gambiae voltage gated sodi... 24 1.6 AY825872-1|AAV70435.1| 162|Anopheles gambiae voltage gated sodi... 24 1.6 AY825871-1|AAV70434.1| 162|Anopheles gambiae voltage gated sodi... 24 1.6 AY825870-1|AAV70433.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825869-1|AAV70432.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825868-1|AAV70431.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825867-1|AAV70430.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825866-1|AAV70429.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825865-1|AAV70428.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825864-1|AAV70427.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825863-1|AAV70426.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825862-1|AAV70425.1| 162|Anopheles gambiae voltage gated sodi... 24 1.6 AY825861-1|AAV70424.1| 162|Anopheles gambiae voltage gated sodi... 24 1.6 AY825860-1|AAV70423.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825859-1|AAV70422.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825858-1|AAV70421.1| 162|Anopheles gambiae voltage gated sodi... 24 1.6 AY825857-1|AAV70420.1| 162|Anopheles gambiae voltage gated sodi... 24 1.6 AY825856-1|AAV70419.1| 166|Anopheles gambiae voltage gated sodi... 24 1.6 AY825855-1|AAV70418.1| 166|Anopheles gambiae voltage gated sodi... 24 1.6 AY825854-1|AAV70417.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825853-1|AAV70416.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825852-1|AAV70415.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825851-1|AAV70414.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825850-1|AAV70413.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825849-1|AAV70412.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825848-1|AAV70411.1| 160|Anopheles gambiae voltage gated sodi... 24 1.6 AY825847-1|AAV70410.1| 160|Anopheles gambiae voltage gated sodi... 24 1.6 AY825846-1|AAV70409.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825845-1|AAV70408.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825844-1|AAV70407.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825843-1|AAV70406.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825842-1|AAV70405.1| 160|Anopheles gambiae voltage gated sodi... 24 1.6 AY825841-1|AAV70404.1| 160|Anopheles gambiae voltage gated sodi... 24 1.6 AY825840-1|AAV70403.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825839-1|AAV70402.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825838-1|AAV70401.1| 162|Anopheles gambiae voltage gated sodi... 24 1.6 AY825837-1|AAV70400.1| 162|Anopheles gambiae voltage gated sodi... 24 1.6 AY825836-1|AAV70399.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825835-1|AAV70398.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825834-1|AAV70397.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY825833-1|AAV70396.1| 161|Anopheles gambiae voltage gated sodi... 24 1.6 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 1.6 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 1.6 AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. 22 6.4 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 22 6.4 AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding pr... 22 8.4 >Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS11 protein. Length = 151 Score = 167 bits (406), Expect = 1e-43 Identities = 77/117 (65%), Positives = 96/117 (82%) Frame = +2 Query: 5 KAFQKQATVFLNRKGGMKRKDMRHHKNVGLGFKTPREAIEGTYIDKKCPFTGNVSIRGRI 184 +AFQKQ + LNRK ++K +R H ++GLGFKTP+EAI GTYIDKKCPFTG++SIRGRI Sbjct: 8 RAFQKQLGINLNRKNVSRKKGLRMHHSIGLGFKTPKEAITGTYIDKKCPFTGHISIRGRI 67 Query: 185 LTGVVQKMKMQRTVVIRRDYLHYLPKYNRFEKRHRNMSVHLSPCFRDVEIGDIVTIG 355 LTGVV+K + + IRRDYL ++ KY+ FEKR+RNM +HLSPCFRDVE GDIVT+G Sbjct: 68 LTGVVRKCIV--LLYIRRDYLQFIRKYDTFEKRNRNMRLHLSPCFRDVEAGDIVTLG 122 >AY825878-1|AAV70441.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825877-1|AAV70440.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825876-1|AAV70439.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825875-1|AAV70438.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825874-1|AAV70437.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 95 IHKPNRYKIISMDIPICRGDM 115 >AY825873-1|AAV70436.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 95 IHKPNRYKIISMDIPICRGDM 115 >AY825872-1|AAV70435.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 95 IHKPNRYKIISMDIPICRGDM 115 >AY825871-1|AAV70434.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 95 IHKPNRYKIISMDIPICRGDM 115 >AY825870-1|AAV70433.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825869-1|AAV70432.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825868-1|AAV70431.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825867-1|AAV70430.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825866-1|AAV70429.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825865-1|AAV70428.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825864-1|AAV70427.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825863-1|AAV70426.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825862-1|AAV70425.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 95 IHKPNRYKIISMDIPICRGDM 115 >AY825861-1|AAV70424.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 95 IHKPNRYKIISMDIPICRGDM 115 >AY825860-1|AAV70423.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 95 IHKPNRYKIISMDIPICRGDM 115 >AY825859-1|AAV70422.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 95 IHKPNRYKIISMDIPICRGDM 115 >AY825858-1|AAV70421.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 95 IHKPNRYKIISMDIPICRGDM 115 >AY825857-1|AAV70420.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 95 IHKPNRYKIISMDIPICRGDM 115 >AY825856-1|AAV70419.1| 166|Anopheles gambiae voltage gated sodium channel protein. Length = 166 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 95 IHKPNRYKIISMDIPICRGDM 115 >AY825855-1|AAV70418.1| 166|Anopheles gambiae voltage gated sodium channel protein. Length = 166 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 95 IHKPNRYKIISMDIPICRGDM 115 >AY825854-1|AAV70417.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825853-1|AAV70416.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825852-1|AAV70415.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825851-1|AAV70414.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825850-1|AAV70413.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825849-1|AAV70412.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825848-1|AAV70411.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 93 IHKPNRYKIISMDIPICRGDM 113 >AY825847-1|AAV70410.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 93 IHKPNRYKIISMDIPICRGDM 113 >AY825846-1|AAV70409.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 95 IHKPNRYKIISMDIPICRGDM 115 >AY825845-1|AAV70408.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 95 IHKPNRYKIISMDIPICRGDM 115 >AY825844-1|AAV70407.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 95 IHKPNRYKIISMDIPICRGDM 115 >AY825843-1|AAV70406.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 95 IHKPNRYKIISMDIPICRGDM 115 >AY825842-1|AAV70405.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825841-1|AAV70404.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825840-1|AAV70403.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825839-1|AAV70402.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825838-1|AAV70401.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 95 IHKPNRYKIISMDIPICRGDM 115 >AY825837-1|AAV70400.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 95 IHKPNRYKIISMDIPICRGDM 115 >AY825836-1|AAV70399.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825835-1|AAV70398.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825834-1|AAV70397.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY825833-1|AAV70396.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 94 IHKPNRYKIISMDIPICRGDM 114 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.2 bits (50), Expect = 1.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 190 GEDAAADRNVTSEGTLLVNVGT 125 GED D+ S+GTLL +GT Sbjct: 1268 GEDDTGDKKTDSDGTLL-EIGT 1288 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 364 LHSPDRYNITNLHVPEARRQM 302 +H P+RY I ++ +P R M Sbjct: 1919 IHKPNRYKIISMDIPICRGDM 1939 >AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. Length = 165 Score = 22.2 bits (45), Expect = 6.4 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +1 Query: 67 HASP*ECWFRLQNSQRGD*GYLH 135 H P EC + +S GYLH Sbjct: 82 HYEPMECHSAVNSSSNSSTGYLH 104 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 22.2 bits (45), Expect = 6.4 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 62 SSSCHLSCSGKRWPVS 15 +SSC L +G RW VS Sbjct: 447 ASSCFLPEAGARWDVS 462 >AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding protein AgamOBP45 protein. Length = 356 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 312 GDKCTDIFLCRFSNLLYLGR 253 GD+CT+++L L LGR Sbjct: 249 GDQCTEVYLAYRDVLGELGR 268 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 408,528 Number of Sequences: 2352 Number of extensions: 7624 Number of successful extensions: 58 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 27944475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -