BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31535 (608 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2864| Best HMM Match : ATP-synt_8 (HMM E-Value=1.2) 33 0.24 SB_25608| Best HMM Match : DUF433 (HMM E-Value=1.4) 28 5.1 SB_12229| Best HMM Match : DUF433 (HMM E-Value=1.4) 28 5.1 SB_9474| Best HMM Match : EGF (HMM E-Value=2e-08) 28 5.1 >SB_2864| Best HMM Match : ATP-synt_8 (HMM E-Value=1.2) Length = 250 Score = 32.7 bits (71), Expect = 0.24 Identities = 19/53 (35%), Positives = 28/53 (52%) Frame = +2 Query: 425 IEILAIRLTNRIPQILLALVIQIRGR*PCEVRCSDKRFVVCCMLVLVSEMLIW 583 IE+LA+ LT+R PQ +R EV+C RFV+ + S +L+W Sbjct: 173 IEVLALALTHRPPQSPRRCCTVLR-----EVQCPQDRFVIATISTHTSILLVW 220 >SB_25608| Best HMM Match : DUF433 (HMM E-Value=1.4) Length = 396 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -3 Query: 606 ILTLKSMRHINISDTRTNIQHTTKRLSLHLTSHGYL 499 ++ L RH+N + T T QH T + + H YL Sbjct: 117 VVALHVARHVNTNGTDTRCQHETLPIDSVIDLHNYL 152 >SB_12229| Best HMM Match : DUF433 (HMM E-Value=1.4) Length = 351 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -3 Query: 606 ILTLKSMRHINISDTRTNIQHTTKRLSLHLTSHGYL 499 ++ L RH+N + T T QH T + + H YL Sbjct: 117 VVALHVARHVNTNGTDTRCQHETLPIDSVIDLHNYL 152 >SB_9474| Best HMM Match : EGF (HMM E-Value=2e-08) Length = 237 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -2 Query: 328 FTYHYEVEKPKVPYKLVLHVEPYNIQKKKK 239 + YH +KPKVP++L + P I+K ++ Sbjct: 50 YFYHKRSKKPKVPHQLARILLPQKIKKSQR 79 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,320,931 Number of Sequences: 59808 Number of extensions: 285045 Number of successful extensions: 598 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 598 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -