BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31534 (552 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26890.1 68415.m03226 DNAJ heat shock N-terminal domain-conta... 30 1.2 At2g27110.2 68415.m03258 far-red impaired responsive protein, pu... 29 2.1 At2g27110.1 68415.m03257 far-red impaired responsive protein, pu... 29 2.1 At5g65683.1 68418.m08265 zinc finger (C3HC4-type RING finger) fa... 29 2.7 At4g31877.1 68417.m04530 expressed protein 28 4.8 >At2g26890.1 68415.m03226 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226: DnaJ domain Length = 2554 Score = 29.9 bits (64), Expect = 1.2 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = -1 Query: 501 GQVETLAVGSVEAR--GSKSVDEHASVDPFSHPARSPHENIEV 379 G+ ET++ G V+A GS V+E S DP S P ++P E + + Sbjct: 2332 GRRETMSSGEVKAEEIGSDGVNE--STDPSSLPGQTPQERVRL 2372 >At2g27110.2 68415.m03258 far-red impaired responsive protein, putative similar to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282 Length = 851 Score = 29.1 bits (62), Expect = 2.1 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +1 Query: 304 ETFVHT-NELQMEEAVKVFRVLYYAKDFDVFMRTACWMRERIN 429 ETF HT N ++ + FRV + D ++ T C+ R N Sbjct: 495 ETFAHTANRIEDDGTTSTFRVANFENDNKAYIVTFCYPEMRAN 537 >At2g27110.1 68415.m03257 far-red impaired responsive protein, putative similar to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282 Length = 851 Score = 29.1 bits (62), Expect = 2.1 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +1 Query: 304 ETFVHT-NELQMEEAVKVFRVLYYAKDFDVFMRTACWMRERIN 429 ETF HT N ++ + FRV + D ++ T C+ R N Sbjct: 495 ETFAHTANRIEDDGTTSTFRVANFENDNKAYIVTFCYPEMRAN 537 >At5g65683.1 68418.m08265 zinc finger (C3HC4-type RING finger) family protein contains Pfam profiles PF00097: Zinc finger, C3HC4 type (RING finger), PF00092: von Willebrand factor type A domain Length = 717 Score = 28.7 bits (61), Expect = 2.7 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 1/69 (1%) Frame = -1 Query: 540 AVNEEVGIDLVRSGQVETLAVGSVEARGSKSVDEHASVDPFS-HPARSPHENIEVLSVVE 364 AVN G D +R ++ + G ++ + DE + P S + HE+ E VE Sbjct: 197 AVNNNFGSDPIRRPEIREIKTG--KSLRVYNDDEPLAYSPVSLAQINTIHESDEN-DDVE 253 Query: 363 DSEDFDGFF 337 D +DF GFF Sbjct: 254 DDDDFPGFF 262 >At4g31877.1 68417.m04530 expressed protein Length = 102 Score = 27.9 bits (59), Expect = 4.8 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 4/47 (8%) Frame = -2 Query: 341 SSIWSSLVWTKVSPRGSMPILYISMNCLTTSTFM----YLSQLFSML 213 +S+ SL++ S S+P+ + S NC+ S F+ ++SQ + ML Sbjct: 6 ASLACSLLYLSDSGSDSVPVTFSSSNCVPISHFLSHVFFISQRYEML 52 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,726,856 Number of Sequences: 28952 Number of extensions: 206866 Number of successful extensions: 593 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 593 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1043173136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -