BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31529 (765 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 27 0.12 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 22 6.2 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 21 8.2 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 21 8.2 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 27.5 bits (58), Expect = 0.12 Identities = 23/67 (34%), Positives = 27/67 (40%), Gaps = 5/67 (7%) Frame = -3 Query: 685 WRTGPSRTRSVWTSSP----TN*KRPVFSPRTLTENPTR-FRENWPSLKTNSKSPKTVSS 521 W T PS S T+SP T +R + T T TR NWP+ T P V Sbjct: 1035 WTTKPSTWWSSTTTSPWWTTTTTRRTTTTRPTTTSTTTRPTTTNWPTQGTTIPPPAVVMP 1094 Query: 520 LVTLRSQ 500 V SQ Sbjct: 1095 EVDKPSQ 1101 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 21.8 bits (44), Expect = 6.2 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -1 Query: 81 VIIFINILCKFIYDFQ*NLIYNKKKKK 1 VII I I +F+Y F LI + K K Sbjct: 130 VIIDIEIYSQFLYGFMIYLILDTIKSK 156 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/28 (25%), Positives = 12/28 (42%) Frame = -3 Query: 235 SWLVTKLSHSTYRPHTYTNRTCTHTYAA 152 SW + +++P CTH + A Sbjct: 32 SWAGYRNGEGSFKPQNINANLCTHVHYA 59 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 472 PTTFNSSSSSEILASPD 522 P F ++SSS L SPD Sbjct: 216 PAEFPTTSSSSALESPD 232 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,007 Number of Sequences: 336 Number of extensions: 2663 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -