BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31526 (735 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 3.0 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 3.0 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 23 3.9 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 21 9.1 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 9.1 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 338 LRVAPEEHPVLLTEAPLNPKANREKM 415 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.0 bits (47), Expect = 3.0 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = -3 Query: 700 LLDVTNDFPLSGGGERVTPLGEDLHEVVGQVATSQVQTEDGVGQS-VTFVDGYGVGDT 530 ++D+T S G+ V +L+ +VG A + E+G G + VT + + DT Sbjct: 18 MVDLTQCLQESSTGQSVEFSPMELNALVGTPAAPNMPAEEGEGMAGVTGEEPFDTLDT 75 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 346 DTQLIVEGVVPDLLHVI 296 + Q +V+ V PD+LH+I Sbjct: 21 NNQTVVDKVPPDMLHLI 37 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 21.4 bits (43), Expect = 9.1 Identities = 10/37 (27%), Positives = 16/37 (43%) Frame = -1 Query: 513 TIPVVRPEAYSESTAWMATYMAGELKVSNMIWVIFSL 403 T+P + E + AWM G L+ N + F + Sbjct: 33 TLPGYKIECVGDDIAWMKFDKEGRLRAINPEYGFFGV 69 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 9.1 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 101 GMCKAGFAGD 130 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,746 Number of Sequences: 438 Number of extensions: 3803 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -