BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31521 (793 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY069669-1|AAL39814.1| 377|Drosophila melanogaster LD44591p pro... 60 5e-09 AF274008-1|AAF86976.1| 377|Drosophila melanogaster cAMP-depende... 60 5e-09 AE013599-988|AAO41465.1| 377|Drosophila melanogaster CG15862-PC... 60 5e-09 AE013599-987|AAM71046.3| 377|Drosophila melanogaster CG15862-PB... 60 5e-09 AE013599-986|AAF58862.2| 377|Drosophila melanogaster CG15862-PA... 60 5e-09 >AY069669-1|AAL39814.1| 377|Drosophila melanogaster LD44591p protein. Length = 377 Score = 59.7 bits (138), Expect = 5e-09 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 1 PCMEIMKRNIDDYEEQLVKLFGDKSNLTDVR 93 PCM+IMKRNIDDYE QLVK+FG K+N+TD R Sbjct: 347 PCMDIMKRNIDDYESQLVKIFGSKNNITDTR 377 >AF274008-1|AAF86976.1| 377|Drosophila melanogaster cAMP-dependent protein kinasetype II regulatory subunit protein. Length = 377 Score = 59.7 bits (138), Expect = 5e-09 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 1 PCMEIMKRNIDDYEEQLVKLFGDKSNLTDVR 93 PCM+IMKRNIDDYE QLVK+FG K+N+TD R Sbjct: 347 PCMDIMKRNIDDYESQLVKIFGSKNNITDTR 377 >AE013599-988|AAO41465.1| 377|Drosophila melanogaster CG15862-PC, isoform C protein. Length = 377 Score = 59.7 bits (138), Expect = 5e-09 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 1 PCMEIMKRNIDDYEEQLVKLFGDKSNLTDVR 93 PCM+IMKRNIDDYE QLVK+FG K+N+TD R Sbjct: 347 PCMDIMKRNIDDYESQLVKIFGSKNNITDTR 377 >AE013599-987|AAM71046.3| 377|Drosophila melanogaster CG15862-PB, isoform B protein. Length = 377 Score = 59.7 bits (138), Expect = 5e-09 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 1 PCMEIMKRNIDDYEEQLVKLFGDKSNLTDVR 93 PCM+IMKRNIDDYE QLVK+FG K+N+TD R Sbjct: 347 PCMDIMKRNIDDYESQLVKIFGSKNNITDTR 377 >AE013599-986|AAF58862.2| 377|Drosophila melanogaster CG15862-PA, isoform A protein. Length = 377 Score = 59.7 bits (138), Expect = 5e-09 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 1 PCMEIMKRNIDDYEEQLVKLFGDKSNLTDVR 93 PCM+IMKRNIDDYE QLVK+FG K+N+TD R Sbjct: 347 PCMDIMKRNIDDYESQLVKIFGSKNNITDTR 377 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,744,216 Number of Sequences: 53049 Number of extensions: 528071 Number of successful extensions: 882 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 854 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 882 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3675273108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -