BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31520 (421 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 26 0.64 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 25 1.5 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 6.0 AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 22 7.9 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 25.8 bits (54), Expect = 0.64 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -2 Query: 381 DFKRCMLNQSKTITV*QINTHCATSFSENIIGAL 280 +F RCM+N+ KT V ++ A F+ +IIG++ Sbjct: 153 EFDRCMMNEIKTSPVVEMKDLLA-RFTTDIIGSV 185 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 24.6 bits (51), Expect = 1.5 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +2 Query: 2 RKTGRYIAIGPVCMLTCHALCQVVECRVNFSGVL 103 R TGRY P C C+ V+C+ +G L Sbjct: 665 RYTGRYCEKCPTCAGRCNEFKHCVQCQQYKTGPL 698 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 22.6 bits (46), Expect = 6.0 Identities = 15/56 (26%), Positives = 26/56 (46%) Frame = +1 Query: 106 SLIRIHFNSTPDSKSICMYFL*LDYRI*SFFLKRYLSVFLTSLTSISSSPKTLDSV 273 S +R S P+S S+ F DYR + L R F TS+ + ++ +++ Sbjct: 260 SRVRNELPSAPNSLSVRYNFRLTDYRKLNSILSRADWSFFYQCTSVDEAVQSFNAL 315 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -3 Query: 80 DTPQPDTVRDTLAYIPDR 27 D P DT+ D AY DR Sbjct: 115 DQPDADTLGDVAAYARDR 132 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 393,487 Number of Sequences: 2352 Number of extensions: 5636 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34632603 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -