BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31519 (672 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0003 + 29476-29847,30192-31519,31612-31722,31836-32112,322... 29 4.5 >05_01_0003 + 29476-29847,30192-31519,31612-31722,31836-32112, 32233-33714 Length = 1189 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/48 (27%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = -1 Query: 216 LS*VLCS**YFD*KFSMTLNI-ESHFSHTGLVFFNKWSTVLFSIFYNA 76 +S ++C Y + F +TL + E++ S +G F+N W+ +++F+ + Sbjct: 904 ISAMICYFFYKNITFGVTLFLYEAYTSFSGQTFYNDWALSTYNVFFTS 951 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,107,861 Number of Sequences: 37544 Number of extensions: 262854 Number of successful extensions: 462 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 462 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1703141568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -