BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31518 (799 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g30600.2 68415.m03729 BTB/POZ domain-containing protein conta... 32 0.51 At2g30600.1 68415.m03728 BTB/POZ domain-containing protein conta... 32 0.51 At3g10100.1 68416.m01210 filament protein-related similar to YEA... 29 2.7 At2g04300.1 68415.m00422 leucine-rich repeat protein kinase, put... 29 2.7 At2g47180.1 68415.m05892 galactinol synthase, putative similar t... 29 3.6 At4g20730.1 68417.m03013 filament protein-related similar to Cyt... 29 4.7 At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family... 29 4.7 At3g07420.1 68416.m00884 asparaginyl-tRNA synthetase 2, cytoplas... 29 4.7 At5g23790.1 68418.m02793 galactinol synthase, putative similar t... 28 6.2 At4g26250.1 68417.m03778 galactinol synthase, putative similar t... 28 6.2 At5g50400.1 68418.m06242 calcineurin-like phosphoesterase family... 28 8.3 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 28 8.3 At4g32200.1 68417.m04582 DNA-binding HORMA domain-containing pro... 28 8.3 At1g09350.1 68414.m01046 galactinol synthase, putative contains ... 28 8.3 >At2g30600.2 68415.m03729 BTB/POZ domain-containing protein contains Pfam PF00651: BTB/POZ domain; contains Interpro IPR000210/ PS50097: BTBB/POZ domain; similar to MigA (GI:1841872) [Dictyostelium discoideum] Length = 809 Score = 31.9 bits (69), Expect = 0.51 Identities = 37/139 (26%), Positives = 61/139 (43%), Gaps = 14/139 (10%) Frame = +1 Query: 70 DVATDDNLQYQFFPVSSGSVQFKVRAANDAHIAL--TTGPQ------ESDPMYEVMIGGW 225 + A D+L+++ G V F A ND + G Q ++ P Y V+IG Sbjct: 16 ECAWSDDLKFR--EAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNSPHYIVIIGSN 73 Query: 226 GNAKSVIRKNRTKPDKVEIESPGILNGG-EYRGFWVRWDSGIISAGREGEAIPF----IS 390 N + I+ + V+ E+ + E++ +W+ G+IS G+ PF Sbjct: 74 RNRRLKIQVDGKSV--VDEEASDLCRCSLEFQSYWISIYDGLISIGK--GRYPFQNLVFK 129 Query: 391 WSDPEP-FPVYYVGVCTGW 444 W DP+P V YVG+ + W Sbjct: 130 WQDPKPNCNVQYVGL-SSW 147 >At2g30600.1 68415.m03728 BTB/POZ domain-containing protein contains Pfam PF00651: BTB/POZ domain; contains Interpro IPR000210/ PS50097: BTBB/POZ domain; similar to MigA (GI:1841872) [Dictyostelium discoideum] Length = 809 Score = 31.9 bits (69), Expect = 0.51 Identities = 37/139 (26%), Positives = 61/139 (43%), Gaps = 14/139 (10%) Frame = +1 Query: 70 DVATDDNLQYQFFPVSSGSVQFKVRAANDAHIAL--TTGPQ------ESDPMYEVMIGGW 225 + A D+L+++ G V F A ND + G Q ++ P Y V+IG Sbjct: 16 ECAWSDDLKFR--EAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNSPHYIVIIGSN 73 Query: 226 GNAKSVIRKNRTKPDKVEIESPGILNGG-EYRGFWVRWDSGIISAGREGEAIPF----IS 390 N + I+ + V+ E+ + E++ +W+ G+IS G+ PF Sbjct: 74 RNRRLKIQVDGKSV--VDEEASDLCRCSLEFQSYWISIYDGLISIGK--GRYPFQNLVFK 129 Query: 391 WSDPEP-FPVYYVGVCTGW 444 W DP+P V YVG+ + W Sbjct: 130 WQDPKPNCNVQYVGL-SSW 147 >At3g10100.1 68416.m01210 filament protein-related similar to YEAST NUF1 protein (Spindle poly body spacer protein SPC110) (SP:P32380) {Saccharomyces cerevisiae}; similar to Myosin heavy chain, smooth muscle isoform (SMMHC) (SP:P35749) {Homo sapiens} Length = 1004 Score = 29.5 bits (63), Expect = 2.7 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = +2 Query: 407 LSQFTTSESAQAGVPQAPGKSKMERNSILRTG*SISLDLSPLVLWNS-ITADRTTATFPS 583 LSQF + P ++ E N+ L + DL P+V WN+ ITA +T +T S Sbjct: 70 LSQFDPLIDLEDAYNTQPQYTEAEVNARLLHEDYVEFDLDPVVSWNTEITAKKTLSTTES 129 >At2g04300.1 68415.m00422 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 851 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/56 (26%), Positives = 27/56 (48%) Frame = +1 Query: 193 DPMYEVMIGGWGNAKSVIRKNRTKPDKVEIESPGILNGGEYRGFWVRWDSGIISAG 360 D ++ + +G ++S + T+ D V +PG L+ YR W+ S + S G Sbjct: 675 DEHFQAKLADFGLSRSFPLEGETRVDTVVAGTPGYLDPEYYRTNWLNEKSDVYSFG 730 >At2g47180.1 68415.m05892 galactinol synthase, putative similar to galactinol synthase, isoform GolS-1 GI:5608497 from [Ajuga reptans] Length = 344 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 634 WENT-QSVIRYCRQKPDKVTIPTPGIMNP 717 W +T Q IRYC+Q PDKV P + P Sbjct: 159 WSHTPQYKIRYCQQCPDKVQWPKAELGEP 187 >At4g20730.1 68417.m03013 filament protein-related similar to Cytadherence high molecular weight protein 2 (SP:P47460) [Mycoplasma genitalium]; similar to YEAST NUF1 protein (Spindle poly body spacer protein SPC110) (SP:P32380) {Saccharomyces cerevisiae}; also SP|Q9UKX2|MYH2_HUMAN Myosin heavy chain, skeletal muscle, SP|P31732|OV71_ONCVO Muscle cell intermediate filament protein SP|P12882|MYH1_HUMAN Myosin heavy chain, skeletal muscle,. SP|Q17107|AV71_ACAVI Muscle cell intermediate filament protein Length = 800 Score = 28.7 bits (61), Expect = 4.7 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = +2 Query: 407 LSQFTTSESAQAGVPQAPGKSKMERNSILRTG*SISLDLSPLVLWNS-ITADRTTATFPS 583 L+QF + P ++ E N+ L + DL P+V WN+ ITA +T +T S Sbjct: 71 LAQFDPLIDLEDAYNTQPQYTEAEVNARLLHEDHVEFDLDPVVSWNTEITAKKTLSTTES 130 >At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 300 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -3 Query: 413 GKGSGSDQDMNGIASPSRPAEIMPLSQRTQKPRYSPPLRIPG 288 G G S++D+N P P + P +TQ+ Y P + PG Sbjct: 16 GPGQNSERDIN--QPPPPPPQSQPPPPQTQQQTYPPVMGYPG 55 >At3g07420.1 68416.m00884 asparaginyl-tRNA synthetase 2, cytoplasmic / asparagine-tRNA ligase 2 (SYNC2) nearly identical to SP|Q9SW95; HMM hit: tRNA synthetases class II Length = 638 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +1 Query: 208 VMIGGWGNAKSVIRKNRTKPDKVEIESPGILNGGE 312 V+IGGW + ++KN P + +P +GG+ Sbjct: 50 VVIGGWVKSARAVKKNSPPPPLPVVAAPSPSSGGD 84 >At5g23790.1 68418.m02793 galactinol synthase, putative similar to galactinol synthase, isoform GolS-1 GI:5608497 from [Ajuga reptans]; contains Pfam profile: PF01501 glycosyl transferase family 8 Length = 333 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +1 Query: 634 WENT-QSVIRYCRQKPDKVTIPTPGIMNP 717 W T Q I YC+Q P+KVT P + P Sbjct: 151 WSKTPQYKIGYCQQSPEKVTWPVESLGAP 179 >At4g26250.1 68417.m03778 galactinol synthase, putative similar to galactinol synthase, isoform GolS-1 [Ajuga reptans] GI:5608497; contains Pfam profile: PF01501 glycosyl transferase family 8 Length = 336 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 634 WENT-QSVIRYCRQKPDKVTIPTPGIMNP 717 W T Q I YC+Q P+KVT P + +P Sbjct: 154 WSKTPQFKIGYCQQCPEKVTWPVESLGSP 182 >At5g50400.1 68418.m06242 calcineurin-like phosphoesterase family protein contains Pfam profile: PF00149 calcineurin-like phosphoesterase Length = 611 Score = 27.9 bits (59), Expect = 8.3 Identities = 21/73 (28%), Positives = 30/73 (41%), Gaps = 2/73 (2%) Frame = +1 Query: 184 QESDPMYEVMIGGWGNAKSVIRKNRTK--PDKVEIESPGILNGGEYRGFWVRWDSGIISA 357 Q +D + + GG N V N K + P + G ++ V W SG Sbjct: 135 QRADFSFALFTGGLSNPTLVSVSNHVSFINPKAPVY-PRLALGKKWDEMTVTWTSGY--- 190 Query: 358 GREGEAIPFISWS 396 GEA+PF+ WS Sbjct: 191 -NIGEAVPFVEWS 202 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 27.9 bits (59), Expect = 8.3 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -3 Query: 359 PAEIMPLSQRTQKPRYSPPLRIP 291 P E+ P ++ P+YSPP+ +P Sbjct: 171 PLELPPFLKKPCPPKYSPPVEVP 193 >At4g32200.1 68417.m04582 DNA-binding HORMA domain-containing protein similar to meiotic asynaptic mutant 1 [Arabidopsis thaliana] GI:7939627, aysnaptic 1 [Brassica oleracea var. alboglabra] GI:23506946; contains Pfam profile PF02301: HORMA domain Length = 1399 Score = 27.9 bits (59), Expect = 8.3 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = +2 Query: 407 LSQFTTSESAQAGVPQAPGKSKMERNSILRTG*SISLDLSPLVLWNS-ITADRTTATFPS 583 L+QF + P ++ E N+ L + DL P+V WN+ ITA +T +T S Sbjct: 662 LAQFDPLIDLEDAYNTQPQYTEAEVNARLLHEDHVEFDLVPVVSWNTEITAKKTLSTTES 721 >At1g09350.1 68414.m01046 galactinol synthase, putative contains Pfam profile: PF01501 glycosyl transferase family 8 Length = 334 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = +1 Query: 634 WENT-QSVIRYCRQKPDKVTIP 696 W +T Q I YC+Q PDKVT P Sbjct: 145 WSHTPQYKIGYCQQCPDKVTWP 166 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,417,326 Number of Sequences: 28952 Number of extensions: 436501 Number of successful extensions: 1293 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1216 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1293 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1804564000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -