BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31512 (576 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC222.10c |byr4||two-component GAP Byr4|Schizosaccharomyces po... 27 2.6 SPAC13A11.04c |ubp8||ubiquitin C-terminal hydrolase Ubp8|Schizos... 26 4.5 >SPAC222.10c |byr4||two-component GAP Byr4|Schizosaccharomyces pombe|chr 1|||Manual Length = 665 Score = 26.6 bits (56), Expect = 2.6 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = +2 Query: 284 HLGST--WRPKISKRSTTKHKNGL 349 H GST W + RST+KH+N L Sbjct: 417 HAGSTQEWHSHTTPRSTSKHENNL 440 >SPAC13A11.04c |ubp8||ubiquitin C-terminal hydrolase Ubp8|Schizosaccharomyces pombe|chr 1|||Manual Length = 449 Score = 25.8 bits (54), Expect = 4.5 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = -3 Query: 478 SLKCIYFCLAYKKKRIAYLVFXSFSLIIN----S*CIKSYVFNEK 356 SLK + CL KK+R+A SL IN C++ +V EK Sbjct: 268 SLKNVVTCLDCKKERVAVDPLMDISLDINEPTLQGCLERFVSKEK 312 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,848,079 Number of Sequences: 5004 Number of extensions: 32628 Number of successful extensions: 95 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 246098644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -