BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31510 (746 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34335| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 28 9.2 >SB_34335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 32.7 bits (71), Expect = 0.33 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -2 Query: 124 SVTQIIYILDCHNLPASIFFLYIYCR 47 ++ Q+IY +CHNLP + FL CR Sbjct: 15 TLQQLIYTRNCHNLPVEVLFLENSCR 40 >SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) Length = 488 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 13 IYEYSFKNTLTNDNKYIKKKLMQASYGNLRYK 108 +Y ++ +N N+ IKKK + SYG L Y+ Sbjct: 339 LYGFANRNGRFYKNRCIKKKDLPVSYGGLHYR 370 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,128,297 Number of Sequences: 59808 Number of extensions: 381545 Number of successful extensions: 592 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 591 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -