BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31508 (358 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_43579| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.8 SB_8084| Best HMM Match : EGF_CA (HMM E-Value=2.8026e-45) 26 7.8 >SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1211 Score = 26.6 bits (56), Expect = 5.9 Identities = 11/43 (25%), Positives = 20/43 (46%) Frame = -3 Query: 215 PSFFVNLTMQSSDSPILRIAPQTTYILDVSAARPVAGSTSAIT 87 P V ++ Q +P + +AP+TT + + + A T T Sbjct: 396 PEISVTISTQPKKAPGITVAPETTVVPETTVASETTAETHQTT 438 >SB_43579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 26.2 bits (55), Expect = 7.8 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 49 RLIHAKDHASVQLVIADVDPATGR 120 R+ H +HA Q++ A +DP TG+ Sbjct: 44 RVHHGINHAKSQILTAKLDPLTGK 67 >SB_8084| Best HMM Match : EGF_CA (HMM E-Value=2.8026e-45) Length = 3094 Score = 26.2 bits (55), Expect = 7.8 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = -3 Query: 197 LTMQSSDSPILRIAPQTTYILDVSAA 120 +T +++ +P +AP+TT +L+ SAA Sbjct: 7 VTAETTAAPETTVAPETTAVLETSAA 32 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,191,656 Number of Sequences: 59808 Number of extensions: 156745 Number of successful extensions: 452 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 372 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 452 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 560496285 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -